Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021331297.1 | Gene: | LOC100331219 / 100331219 | -ID: | - | Length: | 440 | Species: | Danio rerio |
Alignment Length: | 250 | Identity: | 66/250 - (26%) |
---|---|---|---|
Similarity: | 100/250 - (40%) | Gaps: | 33/250 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 276 HPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDR-YTCKFCGKVFPRSANLTRHLRTHTGEQPY 339
Fly 340 KCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSG-- 402
Fly 403 --------VSERMH----------CIRRFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQ 449
Fly 450 QQQHQSTATS----ASSSCSSSRDTPTSSHEEADHAPAT--STADTAAPSSSRDQ 498 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 26/63 (41%) |
zf-C2H2 | 311..333 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 313..333 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 353..377 | CDD:290200 | 10/23 (43%) | ||
zf-C2H2 | 368..390 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 6/19 (32%) | ||
LOC100331219 | XP_021331297.1 | COG5048 | 73..440 | CDD:227381 | 66/249 (27%) |
C2H2 Zn finger | 103..123 | CDD:275368 | |||
C2H2 Zn finger | 131..151 | CDD:275368 | 66/249 (27%) | ||
C2H2 Zn finger | 159..179 | CDD:275368 | 4/21 (19%) | ||
C2H2 Zn finger | 187..207 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 215..235 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 243..263 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 271..291 | CDD:275368 | 2/19 (11%) | ||
C2H2 Zn finger | 299..319 | CDD:275368 | 5/22 (23%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 2/19 (11%) | ||
C2H2 Zn finger | 412..432 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |