DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and LOC100148466

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_001314792.1	Gene:	LOC100148466 / 100148466	-ID:	-	Length:	321	Species:	Danio rerio

Alignment Length:	116	Identity:	45/116 - (38%)
Similarity:	66/116 - (56%)	Gaps:	7/116 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   308 KDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEI 372
            |..:||..||..|..|::|.:|:|.||||:|:.|..||:|||.||||..|:| |:.:|:||.|..
Zfish    91 KKPFTCTQCGNSFNSSSHLNQHMRIHTGEKPFTCTQCEKSFSQSSNLNLHMR-IYTREKPFTCTQ 154

  Fly   373 CERCFGQQTNLDRHLKKHESD------AVSLSALSGVSERMHCIRRFCENP 417
            |.:.|.|.:||:||::.|..:      ....|.:...|..:|.:....|.|
Zfish   155 CGKNFNQSSNLNRHMRIHTGEKPFTCTQCGTSFIRSSSLNLHIMSHNGEKP 205

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	28/54 (52%)
		zf-C2H2	311..333	CDD:278523	9/21 (43%)
		C2H2 Zn finger	313..333	CDD:275368	8/19 (42%)
		zf-H2C2_2	325..349	CDD:290200	12/23 (52%)
		C2H2 Zn finger	341..362	CDD:275368	12/20 (60%)
		zf-H2C2_2	353..377	CDD:290200	10/23 (43%)
		zf-C2H2	368..390	CDD:278523	9/21 (43%)
		C2H2 Zn finger	370..390	CDD:275368	8/19 (42%)
LOC100148466	NP_001314792.1	C2H2 Zn finger	68..88	CDD:275368
		COG5048	<77..320	CDD:227381	45/116 (39%)
		zf-H2C2_2	80..105	CDD:290200	6/13 (46%)
		C2H2 Zn finger	96..116	CDD:275368	8/19 (42%)
		zf-H2C2_2	108..133	CDD:290200	13/24 (54%)
		C2H2 Zn finger	124..144	CDD:275368	12/20 (60%)
		zf-C2H2	150..172	CDD:278523	9/21 (43%)
		C2H2 Zn finger	152..172	CDD:275368	8/19 (42%)
		zf-H2C2_2	164..189	CDD:290200	6/24 (25%)
		C2H2 Zn finger	180..200	CDD:275368	3/19 (16%)
		zf-C2H2	206..228	CDD:278523	45/116 (39%)
		C2H2 Zn finger	208..228	CDD:275368
		zf-H2C2_2	220..245	CDD:290200
		C2H2 Zn finger	236..256	CDD:275368
		zf-H2C2_2	248..273	CDD:290200
		C2H2 Zn finger	264..284	CDD:275368
		zf-H2C2_2	276..301	CDD:290200
		C2H2 Zn finger	292..312	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910