DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and klf9

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001107146.1 Gene:klf9 / 100134994 XenbaseID:XB-GENE-483889 Length:289 Species:Xenopus tropicalis


Alignment Length:215 Identity:61/215 - (28%)
Similarity:93/215 - (43%) Gaps:45/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 CSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSS------------PTGADFPFRHP 244
            |::..:..:||| :.|..||.              |||.|.|            .:|..|...|.
 Frog    85 CTLLTIAKSLLE-LNKYRPLP--------------SPAYSHSDEELCSDSDVTTESGLSFSPSHS 134

  Fly   245 LKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNKD 309
            ...|..:..|.....       :|:.....|.|..||     ..|:.|...|.:..| :...|:.
 Frog   135 PGSCSSSTTPSHMDY-------SPEPGSTQPLPLTQD-----APKSPTRPLGKDTAP-VRSTNEK 186

  Fly   310 RYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERPFKC 370
            |:.|.:  ||||:.:|::|..|.|.||||:|:.|.:  |.:.||.|..|.||.|. |..|:.|:|
 Frog   187 RHRCPYAGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRT-HTGEKQFRC 250

  Fly   371 EICERCFGQQTNLDRHLKKH 390
            .:||:.|.:..:|.:|.::|
 Frog   251 PLCEKRFMRSDHLTKHARRH 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/66 (39%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 10/25 (40%)
C2H2 Zn finger 341..362 CDD:275368 9/22 (41%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
klf9NP_001107146.1 SFP1 <184..272 CDD:227516 35/88 (40%)
C2H2 Zn finger 190..212 CDD:275368 9/21 (43%)
C2H2 Zn finger 220..242 CDD:275368 9/22 (41%)
zf-H2C2_2 234..257 CDD:372612 10/23 (43%)
C2H2 Zn finger 250..270 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.