DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and znf711

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001161471.2 Gene:znf711 / 100124306 XenbaseID:XB-GENE-956382 Length:807 Species:Xenopus tropicalis


Alignment Length:164 Identity:46/164 - (28%)
Similarity:80/164 - (48%) Gaps:25/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRR---KNKARTAATG--- 296
            |||  |....|:..:..|:|..:....|...|:           :|.|.   |.......:|   
 Frog   662 DFP--HKCDVCDKGFHRPSEMKKHSETHKGKKI-----------HQCRHCDFKTSDPFILSGHIL 713

  Fly   297 GNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNI 361
            ...|.:||      :.||.|.:.|.....|.:|::||:|::.|:|:|||.|.:.:|..:|||.:|
 Frog   714 SVHTKDLP------FKCKKCKRGFRIQPELKKHMKTHSGKKVYQCQYCEYSTTDASGFKRHVISI 772

  Fly   362 HNKERPFKCEICERCFGQQTNLDRHLKKHESDAV 395
            |.|:.|.:||.|::.|.:.:..::|:.:|..:|:
 Frog   773 HTKDYPHRCEFCKKGFRRPSEKNQHIMRHHKEAL 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 23/62 (37%)
zf-C2H2 311..333 CDD:278523 6/21 (29%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
zf-H2C2_2 325..349 CDD:290200 11/23 (48%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 5/21 (24%)
C2H2 Zn finger 370..390 CDD:275368 5/19 (26%)
znf711NP_001161471.2 Zfx_Zfy_act 65..414 CDD:368066
COG5048 <422..600 CDD:227381
C2H2 Zn finger 431..451 CDD:275368
C2H2 Zn finger 524..545 CDD:275368
zf-C2H2 551..573 CDD:333835
C2H2 Zn finger 553..573 CDD:275368
zf-H2C2_2 565..589 CDD:372612
C2H2 Zn finger 581..602 CDD:275368
COG5048 <587..768 CDD:227381 32/124 (26%)
C2H2 Zn finger 610..626 CDD:275368
C2H2 Zn finger 638..659 CDD:275368
C2H2 Zn finger 667..687 CDD:275368 3/19 (16%)
C2H2 Zn finger 724..744 CDD:275368 6/19 (32%)
C2H2 Zn finger 752..773 CDD:275368 9/20 (45%)
C2H2 Zn finger 781..801 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.