DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and klf13

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001093690.1 Gene:klf13 / 100101699 XenbaseID:XB-GENE-479837 Length:258 Species:Xenopus tropicalis


Alignment Length:254 Identity:73/254 - (28%)
Similarity:105/254 - (41%) Gaps:63/254 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 GGGGGGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVL---------PG 223
            |...|...|....||.|||               .|...:|..|   .|.|.:|         ||
 Frog    30 GSPDGKSQGSSAAPPPAPP---------------GEDRRENASL---FVVARILADLNQQAPKPG 76

  Fly   224 KVNSPAASSSPTGADFPFRHPL-KKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRK 287
            :......|..|.|.:.....|. |:.:....||.      ||.|:||             |..|:
 Frog    77 EKAECGISLLPAGNEADREPPAGKRADRAATPPL------LPEPSPK-------------QRARR 122

  Fly   288 NKARTAATGGNATPNLPQRNKDRYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSF 348
            .|:|       ..|..|.:   ::.|.:  |.||:.:|::|..||||||||:|::|.:  |.:.|
 Frog   123 GKSR-------CDPESPLK---KHKCPYSGCEKVYGKSSHLKAHLRTHTGERPFECSWDECNKKF 177

  Fly   349 SISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVS-LSALSGVSER 406
            :.|..|.||.|. |..|:.|.|.|||:.|.:..:|.:|.::|.:...| |....|:|.|
 Frog   178 ARSDELARHYRT-HTGEKKFSCPICEKRFMRSDHLTKHARRHANFQPSMLKGRGGISSR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 25/66 (38%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 12/25 (48%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
klf13NP_001093690.1 COG5048 <131..230 CDD:227381 37/102 (36%)
C2H2 Zn finger 138..160 CDD:275368 9/21 (43%)
C2H2 Zn finger 168..190 CDD:275368 8/22 (36%)
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.