DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj12b

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_001335950.1 Gene:kcnj12b / 795702 ZFINID:ZDB-GENE-091118-79 Length:421 Species:Danio rerio


Alignment Length:374 Identity:124/374 - (33%)
Similarity:204/374 - (54%) Gaps:23/374 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PYAHDWAGSTIE------LTPDLGSGPRTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWRYMR 141
            |:.::...|:.|      ..|.||:|.........|:..:|.:.|.|:.||.|..:.|:|.||:.
Zfish     6 PHRYNIVSSSEEDVGRHGTMPALGNGFGNGKIQTRRKLRSRFVNKTGQCNVSFAHMDEQSQRYLA 70

  Fly   142 DLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYVVAYSHGDFIFDPVSGKRMGEGVDPCIYGVH 206
            |:.||.::..|::|..||..::.:|||.|....:::|..|||.       ::..|...||:..|:
Zfish    71 DIFTTCVDSRWRWMFLLFSLAFVISWLAFGFAFWLIALVHGDL-------EKPQENFTPCVMQVN 128

  Fly   207 SWVAMIIYSVETQTTLGFGEKYASEECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTK 271
            |:||..::|||||||:|:|.:..:||||..:|:.|.|.:...:|:..|:..|.||.|||.::...
Zfish   129 SFVAAFLFSVETQTTIGYGFRCVTEECPLAVFMVVFQSIVGCIIDSFMIGAIMAKMARPKKRAET 193

  Fly   272 LKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKIRVYIIVDKRTREGETIK-SHVELKL---EG 332
            :.||..|||..|||:|||::||.:.|:...:|:.:|..:|..:.|.|||.|. ..:::.:   :|
Zfish   194 ILFSHNAVISMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDINVGYDQG 258

  Fly   333 NGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIF 397
            .....::.|..:.|.|:|.|||.......| ..:.||:.|.:.|...|||...:.::|||..||.
Zfish   259 LDRIFLVAPLTILHEINEESPLFGINQQDL-ETSDFEIVVILEGMVEATAMTAQVRSSYLSSEIL 322

  Fly   398 WGQRFVNIIHYDAQNERYIVDYENFNRTISV-DMPMTNPKN--DHLKLE 443
            ||.||..:: ::.:|: |.|||.:|::|..| ..|..:.|:  |:..||
Zfish   323 WGHRFEPVV-FEERNQ-YKVDYSHFHKTYEVPSTPRCSAKDLEDNKSLE 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 110/317 (35%)
kcnj12bXP_001335950.1 IRK_N 2..47 CDD:312087 8/40 (20%)
IRK 48..367 CDD:307239 113/328 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.