DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj6

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_005172632.1 Gene:kcnj6 / 569498 ZFINID:ZDB-GENE-120327-2 Length:402 Species:Danio rerio


Alignment Length:328 Identity:104/328 - (31%)
Similarity:189/328 - (57%) Gaps:22/328 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYV 176
            ::...|.:.|:||.||....:.| ::||:.|:.|||::|:|::.|.:|:..|.::||.|..:.::
Zfish    35 KQKTQRYVRKDGKCNVHHGNVRE-TYRYLTDIFTTLVDLKWRFNLFIFVLVYTVTWLFFGFMWWL 98

  Fly   177 VAYSHGDFIFDPVSGKRMGEGV-DPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLF 240
            :||..||.       :.:|:.. .||:..::.:|:..::|:||:||:|:|.:..:::|||.|.|.
Zfish    99 IAYIRGDL-------EHIGDNQWTPCVNNLNGFVSAFLFSIETETTIGYGHRVITDKCPEGIVLL 156

  Fly   241 VMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESK 305
            ::|.:..:::...||..::.|.::|.::...|.||..|||..|||||||:|||.|.|....:|:.
Zfish   157 LVQSVLGSIVNAFMVGCMFVKISQPKKRAETLVFSTNAVISMRDGRLCLMFRVGDLRNSHIVEAS 221

  Fly   306 IRVYIIVDKRTREGETIK-SHVELKL---EGNGEQIILWPDVVCHVIDETSP---LSQFTTAKLF 363
            ||..:|..|:|:|||.|. :..::.:   .|:....::.|.::||.|::.||   :|:...||  
Zfish   222 IRAKLIKSKQTKEGEFIPLNQTDINVGYDTGDDRLFLVSPLIICHEINQHSPFWEISREHMAK-- 284

  Fly   364 NAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISV 428
              .:.|:.|.:.|...||....:|::||:..||.||.||..::  ..::..|.|||.:|:.....
Zfish   285 --EELEIVVILEGMVEATGMTCQARSSYVASEIKWGYRFTPVL--TLEDGFYEVDYNSFHEIYET 345

  Fly   429 DMP 431
            :.|
Zfish   346 NTP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 103/321 (32%)
kcnj6XP_005172632.1 IRK 42..358 CDD:279361 103/321 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.