DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj1a.4

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001038643.1 Gene:kcnj1a.4 / 569191 ZFINID:ZDB-GENE-050420-186 Length:368 Species:Danio rerio


Alignment Length:345 Identity:105/345 - (30%)
Similarity:175/345 - (50%) Gaps:28/345 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RRSLNRVMEKNGKENVVFRRIPEKS-WRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCY 175
            |....||:.|:|:.|:.|..:..:: :.|:.|..|||:|..|::::..|:.||.|||.:|..|.|
Zfish    17 RSHKKRVVTKDGRCNIKFGNVMHRNRFTYVLDFWTTLVETRWRFIIFYFVASYTLSWFIFGLLWY 81

  Fly   176 VVAYSHGDFIF-DPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFL 239
            .:|.|:||.:: :|....      :||.|.::......:||:|||.|:|:|..|.:::||..:.|
Zfish    82 WLARSNGDLLWQNPPPDH------NPCAYSLNGMTYAFLYSLETQGTVGYGNVYVTDQCPGGVAL 140

  Fly   240 FVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIES 304
            .::||:....|......::..|...|.::...:.||:.||||.:.|.|||..||.:.|:...|.|
Zfish   141 IIIQMIVGLFIRIFWGGIVITKITLPKKRAKTITFSESAVICPKKGTLCLQIRVANLRKTLMIGS 205

  Fly   305 KIRVYIIVDKRT--REGET-IKSHVELKL---EGNGEQIILWPDVVCHVIDETSPLSQFTTAKLF 363
            :|...::   ||  ..||| |...|.:..   .|......:.|..:.|:||::||........: 
Zfish   206 QIYGKLL---RTTITGGETNILDQVSINFMVDAGKDNLFFVCPLTLYHIIDKSSPFFDMAVDTM- 266

  Fly   364 NAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISV 428
            :...|||.|.:.|.:..|:...:.:|||:|:||.||..|:.||....:. :|.||:.||.:.:.|
Zfish   267 HQQDFELVVFLDGMAETTSSSCQVRTSYIPQEIMWGYDFLPIISRSKEG-KYRVDFSNFTKVVPV 330

  Fly   429 DMPMT-------NPKNDHLK 441
              |..       |...:||:
Zfish   331 --PTAHCSRCYHNEPGNHLE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 98/320 (31%)
kcnj1a.4NP_001038643.1 IRK 24..352 CDD:279361 102/338 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588247
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.