DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj12a

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_005162964.1 Gene:kcnj12a / 569146 ZFINID:ZDB-GENE-131126-14 Length:437 Species:Danio rerio


Alignment Length:337 Identity:123/337 - (36%)
Similarity:195/337 - (57%) Gaps:12/337 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYV 176
            |:|.||.::|||:.||.|..:.|||.|||.|:.||.:::.|:|||.:|...:.:|||.|....:|
Zfish    41 RKSRNRFVKKNGQCNVQFTNMDEKSQRYMADIFTTCVDIRWRYMLIVFTLVFVISWLAFGLAFWV 105

  Fly   177 VAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFV 241
            :|..|||  .|..:|   .:...||:..|:.::|..::|:|||||:|:|.:..:||||..:||.|
Zfish   106 IALLHGD--LDNPAG---DDNFTPCVLQVNGFIAAFLFSIETQTTIGYGFRCVTEECPLAVFLVV 165

  Fly   242 MQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKI 306
            .|.:..::|:..|:..|.||.|||.::...|.||..|||..|||:|||::||.:.|:...:|:.:
Zfish   166 FQSIVGSIIDCFMIGAIMAKMARPKKRAQTLLFSHNAVIAMRDGKLCLMWRVGNLRKSHIVEAHV 230

  Fly   307 RVYIIVDKRTREGETIK-SHVELKL---EGNGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAAQ 367
            |..:|..:.|.|||.|. ..:::.:   :|.....::.|..:.|.||..|||...:...| ..|.
Zfish   231 RAQLIKPRVTTEGEYIPLDQLDINVGFDKGLDRIFLVSPITILHQIDHESPLFGISKQDL-ETAD 294

  Fly   368 FELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMPM 432
            ||:.|.:.|...|||...:|::|||..||.||.||..:: ::.:|: |.|||.:|::|..|....
Zfish   295 FEIVVILEGMVEATAMTAQARSSYLASEILWGHRFEPVL-FEEKNQ-YKVDYSHFHKTYEVPSTP 357

  Fly   433 TNPKNDHLKLEY 444
            .....|.::.:|
Zfish   358 RCSAKDMMENKY 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 117/316 (37%)
kcnj12aXP_005162964.1 IRK_N 2..47 CDD:285640 3/5 (60%)
IRK 48..371 CDD:279361 119/330 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.