DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj1a.3

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001038641.1 Gene:kcnj1a.3 / 569137 ZFINID:ZDB-GENE-050420-256 Length:368 Species:Danio rerio


Alignment Length:341 Identity:102/341 - (29%)
Similarity:179/341 - (52%) Gaps:28/341 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 NRVMEKNGKENVVFRRIPEKS-WRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYVVAY 179
            ||::.|:|:.|:.|..:..:: :.|:||..||.:|..|::::..|:.|:.|||.:|..:.|.:|.
Zfish    21 NRLVTKDGRCNIEFDNVMHRNRFAYVRDFWTTFVETRWRFIILYFVASFTLSWFIFGLIWYWLAR 85

  Fly   180 SHGDFIF-DPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFVMQ 243
            |:||.:: :|....      .||:|.|:......|:|:|||.|:.:|..|.:::||..:.|.::|
Zfish    86 SNGDLLWQNPPPDH------TPCVYSVYDMTYAFIFSLETQNTVIYGNVYVTDQCPAGVALIIIQ 144

  Fly   244 MLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKIRV 308
            .:...||......::..|...|.::...:.||:.||||.:.|.|||..||.:.|:...|.|:|..
Zfish   145 TIIGILISIFWCGIVITKITLPKKRAKTITFSESAVICPKKGTLCLQIRVANLRKTLMIGSQIYG 209

  Fly   309 YIIVDKRT--REGETI---KSHVELKLE-GNGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAAQ 367
            .::   ||  ..|||:   :.:::..:: |......:.|..:.|:||::||........| :...
Zfish   210 KLL---RTTVTGGETVILDQVNIDFMVDAGKDNLFFVCPLTLYHIIDKSSPFFDMAVDTL-HQQD 270

  Fly   368 FELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMPM 432
            |||.|.:.|.:..|:...:.:|||:|:||.||..|:.||. .::..||.||:.||.:.:.|  |.
Zfish   271 FELVVFLDGMAETTSSSCQVRTSYIPQEIMWGYDFLPIIS-RSEEGRYQVDFSNFAKVVPV--PT 332

  Fly   433 T-------NPKNDHLK 441
            .       |...:||:
Zfish   333 AHCSRCYHNEPGNHLE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 96/320 (30%)
kcnj1a.3NP_001038641.1 IRK 24..348 CDD:279361 99/336 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.