DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj1a.5

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001038634.2 Gene:kcnj1a.5 / 568823 ZFINID:ZDB-GENE-050420-120 Length:370 Species:Danio rerio


Alignment Length:343 Identity:104/343 - (30%)
Similarity:171/343 - (49%) Gaps:30/343 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 NRVMEKNGKENVVFRRIPEKS-WRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYVVAY 179
            ||::.|:|..|:.|..:..|: :.|:.|..|||:|..|:::|..|:.||.||||:|..|.|.:|.
Zfish    21 NRLVTKDGHCNIEFGNVLHKNGFAYVLDFWTTLVETRWRFILLYFVASYSLSWLIFGLLWYWLAR 85

  Fly   180 SHGDFIFD--PVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFVM 242
            ::||..:.  |...|       ||...|:......:.::||||.:|.|..:.::.||.::.:..:
Zfish    86 NNGDLYWQNPPPDHK-------PCAINVNDMTNAFLNALETQTGMGCGNLFVTDLCPGSVAVLTI 143

  Fly   243 QMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKIR 307
            ||:....|......::..|...|.::...:.||..||||.:.|.|||..||.:.|:...|.|:|.
Zfish   144 QMVVGLFIGIFWCGIVMTKITLPKKRAKTITFSKSAVICPKKGTLCLQIRVANLRKTLMIGSQIY 208

  Fly   308 VYIIVDKRT--REGETI---KSHVELKLE-GNGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAA 366
            ..::   ||  ..|||:   :..::..:: |......:.|..:.|:||::||........| :..
Zfish   209 GKLL---RTTVTGGETVILDQVSIDFMVDAGKDNLFFMCPLTLYHIIDKSSPFFDMAVDTL-HQQ 269

  Fly   367 QFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMP 431
            .|||.|.:.|...:|:...:.:|||:||||.||..|:.||. .::..||.||:.|..:.:.|  |
Zfish   270 DFELVVFLDGMDESTSSSCQVRTSYIPREIMWGYDFLPIIS-RSKERRYRVDFSNIAKVVPV--P 331

  Fly   432 MT-------NPKNDHLKL 442
            ..       |...:||.|
Zfish   332 TAHCSRCYHNEPGNHLHL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 97/321 (30%)
kcnj1a.5NP_001038634.2 IRK 24..348 CDD:279361 100/337 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.