DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj2a

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001318145.1 Gene:kcnj2a / 564522 ZFINID:ZDB-GENE-120319-1 Length:427 Species:Danio rerio


Alignment Length:338 Identity:108/338 - (31%)
Similarity:187/338 - (55%) Gaps:19/338 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GSGPRTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYF 164
            |.|...|......::.:|.::|:|..||.|..:.|||.||:.|:.||.:::.|::|..:|..::.
Zfish    29 GYGNGKSKVHTRHQTQSRFVKKDGHCNVQFINVSEKSQRYLADIFTTCVDIRWRWMFVIFCLAFL 93

  Fly   165 LSWLLFAALCYVVAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYA 229
            ||||.|..:.::||..|||          :......|:..|.|:.|..::|:|||||:|:|.:|.
Zfish    94 LSWLFFGCIFWLVAIFHGD----------LENNGHKCVSNVSSFTAAFLFSIETQTTIGYGYRYV 148

  Fly   230 SEECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVC 294
            ::|||..:|:.|.|.:...:|:..::..:.||.|:|.::...|.||..|.:..||.:|||::||.
Zfish   149 TDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNATVAMRDNKLCLMWRVG 213

  Fly   295 DPREQQSIESKIRVYIIVDKRTREGETI---KSHVELKLEGNGEQIIL-WPDVVCHVIDETSPLS 355
            :.|:...:|:.:|..::..:.|.|||.|   :..:::..:...::|.| .|..:.|.|||.||..
Zfish   214 NLRKSHLVEAHVRAQLLRSRTTAEGEFIPLDQMDIDVGFDSGIDRIFLVSPITIVHEIDEDSPFY 278

  Fly   356 QFTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYE 420
            ..:..::.| :.||:.|.:.|...|||..|:.::||:..||.|..||..:: ::.:| .|.|||.
Zfish   279 DMSKQEMEN-SDFEIVVILEGMVEATAMTTQCRSSYVANEILWAHRFEPVL-FEEKN-YYKVDYS 340

  Fly   421 NFNRTISVDMPMT 433
            .|::|..|  |.|
Zfish   341 RFHKTYEV--PST 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 102/316 (32%)
kcnj2aNP_001318145.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.