DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and Kcnj1

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001161826.1 Gene:Kcnj1 / 56379 MGIID:1927248 Length:392 Species:Mus musculus


Alignment Length:346 Identity:111/346 - (32%)
Similarity:188/346 - (54%) Gaps:21/346 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GLRRSLNRVMEKNGKENVVFRRIPEKS-WRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAAL 173
            |..|...|::.|:|:.|:.|..:..:| :.:..|:.||:::|:|:|.:|:|:.::..||.||..|
Mouse    35 GRSRQRARLVSKDGRCNIEFGNVDAQSRFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLL 99

  Fly   174 CYVVAYSHGDF--IFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPET 236
            .|||||.|.|.  .:.|       :...||:..::...:..::|:|||.|:|:|.::.:|:|...
Mouse   100 WYVVAYVHKDLPEFYPP-------DNRTPCVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATA 157

  Fly   237 IFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQS 301
            |||.:.|.:...:|...|...|.||.:||.::...:.||..|||..|.|:||||.||.:.|:...
Mouse   158 IFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLL 222

  Fly   302 IESKIRVYIIVDKRTREGETI---KSHVELKLE-GNGEQIILWPDVVCHVIDETSPLSQFTTAKL 362
            |.|.|...::....|.|||||   ::::...:: ||.....:.|..:.|:||..||.... .|:.
Mouse   223 IGSHIYGKLLKTTITPEGETIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHM-AAET 286

  Fly   363 FNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTIS 427
            .:...|||.|.:.||..:|:...:.:|||:|.|:.||.|||.|:. ..:..:|.||:.||.:|:.
Mouse   287 LSQQDFELVVFLDGTVESTSATCQVRTSYIPEEVLWGYRFVPIVS-KTKEGKYRVDFHNFGKTVE 350

  Fly   428 VDMP-----MTNPKNDHLKLE 443
            |:.|     :.|.|:...:::
Mouse   351 VETPHCAMCLYNEKDARARMK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 106/324 (33%)
Kcnj1NP_001161826.1 IRK 44..372 CDD:279361 108/337 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.