DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj13

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001039014.1 Gene:kcnj13 / 555691 ZFINID:ZDB-GENE-070129-1 Length:362 Species:Danio rerio


Alignment Length:358 Identity:101/358 - (28%)
Similarity:173/358 - (48%) Gaps:49/358 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 RTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWL 168
            |..|.||  ||..|...:.|.....|..        :|||..|.:.|.|::::..|.||:.|.||
Zfish    26 RLVSKDG--RSQTRGNTRGGSRETCFSA--------LRDLWGTWLALRWRWVVLAFCGSFLLHWL 80

  Fly   169 LFAALCYVVAYSHGDF-IFD---PVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYA 229
            |||.|.|::|..:||. :.|   |..|..:      |:..|:.:.|...:::|||.|:|:|..|.
Zfish    81 LFAVLWYLLARVNGDLDVLDHDSPPPGHVL------CVKHVNGFTAAFSFALETQLTIGYGTMYP 139

  Fly   230 SEECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVC 294
            :.:||..|.|..:|||...::|..:.....||.:||.::...:.||.:||:|.:.|:.||:||||
Zfish   140 NADCPTAIALLALQMLLGLMLEAFITGAFVAKFSRPQKRCDGILFSPQAVVCEQKGQRCLMFRVC 204

  Fly   295 DPREQQSIESKIRVYIIVDKRTREGETIKSHVELKLEGNGEQ---IILWPDVVCHVIDETSPLSQ 356
            :.:.|..::  :.|..::.:...:.|..::.:|..::..|.:   :.|.|....|.::.::|...
Zfish   205 NLQPQPLVD--VSVSAVLYEERDDHELHQTALEFSIDNLGSRSCPLFLSPLTFFHPLNPSTPFIN 267

  Fly   357 FTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRF--VNIIHYD-AQNERYIVD 418
            ..:::    ..|||.|.:..|..:|......:|||||.||.:|..|  |..:|.: ..|.||   
Zfish   268 NPSSQ----THFELVVFLTATQESTGSGYHKRTSYLPDEIQYGYCFSKVTSVHQNKTPNMRY--- 325

  Fly   419 YENFNRTISVDMPMT--------NPKNDHLKLE 443
               |:   :|..|:|        .|..:|:.::
Zfish   326 ---FD---TVPCPLTLANTHTTDTPDKEHVVVQ 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 90/322 (28%)
kcnj13NP_001039014.1 Ion_trans_2 28..325 CDD:328796 92/318 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D956263at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.