DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and KCNJ16

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_005257394.1 Gene:KCNJ16 / 3773 HGNCID:6262 Length:453 Species:Homo sapiens


Alignment Length:325 Identity:102/325 - (31%)
Similarity:181/325 - (55%) Gaps:12/325 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYV 176
            ||:..|::.|:|..||.|:.|..:...|:.|:.|||::.:|::|..:|..||.||||:|.::.::
Human    65 RRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWL 129

  Fly   177 VAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFV 241
            :|:.|||.:.||        .:.||:..|||:....::|:|||||:|:|.:..:|||...:.:.:
Human   130 IAFHHGDLLNDP--------DITPCVDNVHSFTGAFLFSLETQTTIGYGYRCVTEECSVAVLMVI 186

  Fly   242 MQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKI 306
            :|.:.:.:|...::....||.|...::...::||..|:|..|||:|||::|:.|.|....:|..:
Human   187 LQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTV 251

  Fly   307 RVYIIVDKRTREGETIKSHVELKLEGNGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAAQFELY 371
            |..::......||....:..:|||. |.:.|::.|..:.|.||..|||... ..|......||:.
Human   252 RAQLLRYTEDSEGRMTMAFKDLKLV-NDQIILVTPVTIVHEIDHESPLYAL-DRKAVAKDNFEIL 314

  Fly   372 VSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMPMTNPK 436
            |:.:.|..:|....::::||:||||.||.||.:::  :.:.:.|.|:...|..::.|..|..:.|
Human   315 VTFIYTGDSTGTSHQSRSSYVPREILWGHRFNDVL--EVKRKYYKVNCLQFEGSVEVYAPFCSAK 377

  Fly   437  436
            Human   378  377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 97/312 (31%)
KCNJ16XP_005257394.1 IRK 72..387 CDD:279361 99/318 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.