DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and KCNJ11

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_000516.3 Gene:KCNJ11 / 3767 HGNCID:6257 Length:390 Species:Homo sapiens


Alignment Length:339 Identity:119/339 - (35%)
Similarity:185/339 - (54%) Gaps:17/339 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYV 176
            |:...|.:.|.|..||..:.|.|:. |:::|:.|||::|:|.:.|.:|..|:..||||||...::
Human    29 RQRRARFVSKKGNCNVAHKNIREQG-RFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWL 92

  Fly   177 VAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFV 241
            :|::|||..  |..|.     .:||:..:||:.:..::|:|.|.|:|||.:..:||||..|.:.:
Human    93 IAFAHGDLA--PSEGT-----AEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILI 150

  Fly   242 MQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKI 306
            :|.:...:|...|:..|:.|||:..|:...|.||..|||..|.||||.:.||.|.|:...|.:.|
Human   151 VQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATI 215

  Fly   307 RVYIIVDKRTREGETIKSH-VELKLE---GNGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAAQ 367
            .:.::....:.|||.:..| |::.:|   |.....::.|.::.||||..|||.....:.|.:...
Human   216 HMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQD 280

  Fly   368 FELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMPM 432
            .|:.|.:.|....|...|:|:||||..||.||||||.|:  ..::.||.|||..|..|:.|..|:
Human   281 LEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIV--AEEDGRYSVDYSKFGNTVKVPTPL 343

  Fly   433 TNPK---NDHLKLE 443
            ...:   .||..||
Human   344 CTARQLDEDHSLLE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 112/316 (35%)
KCNJ11NP_000516.3 IRK 36..357 CDD:279361 115/330 (35%)
Selectivity filter. /evidence=ECO:0000250 130..135 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.