DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and KCNJ10

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_002232.2 Gene:KCNJ10 / 3766 HGNCID:6256 Length:379 Species:Homo sapiens


Alignment Length:335 Identity:110/335 - (32%)
Similarity:181/335 - (54%) Gaps:22/335 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GPRTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLS 166
            ||      |:||  .||:.|:|:.||....|.:|.:.|::||.||.::::|:|.|.||..::..:
Human    22 GP------GIRR--RRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGT 78

  Fly   167 WLLFAALCYVVAYSHGDFI-FDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYAS 230
            |.||..:.|:||.:|||.: .||.:..      .||:..||:.....::|:|:|||:|:|.:|.|
Human    79 WFLFGVVWYLVAVAHGDLLELDPPANH------TPCVVQVHTLTGAFLFSLESQTTIGYGFRYIS 137

  Fly   231 EECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCD 295
            ||||..|.|.:.|::...::|..:.....||.|||.::...::||..||:...:|:.||:.||.:
Human   138 EECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVAN 202

  Fly   296 PREQQSIESKIRVYIIVDKRTREGETIK-SHVELKLE---GNGEQIILWPDVVCHVIDETSPLSQ 356
            .|:...|..::...::...:|:|||.|: :.|.:..:   .:....::.|....||:||||||..
Human   203 MRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKD 267

  Fly   357 FTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYEN 421
            .....  ....|||.:.:.||..:|:...:.:|||||.||.||..|...|...|.. :||.|:..
Human   268 LPLRS--GEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASG-KYIADFSL 329

  Fly   422 FNRTISVDMP 431
            |::.:.|..|
Human   330 FDQVVKVASP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 103/318 (32%)
KCNJ10NP_002232.2 IRK 31..172 CDD:395797 51/146 (35%)
Selectivity filter. /evidence=ECO:0000250 128..133 2/4 (50%)
IRK_C 179..354 CDD:407551 50/164 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.