DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and KCNJ9

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_004974.2 Gene:KCNJ9 / 3765 HGNCID:6270 Length:393 Species:Homo sapiens


Alignment Length:367 Identity:117/367 - (31%)
Similarity:195/367 - (53%) Gaps:46/367 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SEQNPTFSFPYAHDWAGSTIELTPDLGSGPRTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWR 138
            :::|..||               |.....||       ||...|.:||:|:.||....:.| ::|
Human     2 AQENAAFS---------------PGQEEPPR-------RRGRQRYVEKDGRCNVQQGNVRE-TYR 43

  Fly   139 YMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYVVAYSHGDFIFDPVSGKRMGEGVD---- 199
            |:.||.|||::|:|:..|..|:.:|.|:||.|.|:.:::||..||.           |.::    
Human    44 YLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDL-----------EHLEDTAW 97

  Fly   200 -PCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFVMQMLSAALIEGCMVSVIYAKTA 263
             ||:..::.:||..::|:||:||:|:|.:..:::|||.|.|.::|.:..:::...||..::.|.:
Human    98 TPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKIS 162

  Fly   264 RPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKIRVYIIVDKRTREGETIKSH-VE 327
            :|.::...|.||..||:..|||||||:|||.|.|....:|:.||..:|..::|.|||.|..| .:
Human   163 QPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTD 227

  Fly   328 LKL---EGNGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAAQFELYVSIVGTSPATAQMTEAKT 389
            |.:   .|:....::.|.|:.|.||..||..: .:.:......||:.|.:.|...||....:|::
Human   228 LSVGFDTGDDRLFLVSPLVISHEIDAASPFWE-ASRRALERDDFEIVVILEGMVEATGMTCQARS 291

  Fly   390 SYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMP 431
            |||..|:.||.||.:::  ..::..|.|||.:|:.|..|..|
Human   292 SYLVDEVLWGHRFTSVL--TLEDGFYEVDYASFHETFEVPTP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 108/322 (34%)
KCNJ9NP_004974.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 8/42 (19%)
IRK 25..164 CDD:395797 48/150 (32%)
Selectivity filter. /evidence=ECO:0000250 120..125 2/4 (50%)
IRK_C 171..334 CDD:407551 59/164 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..393
PDZ-binding 390..393
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3449
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.