DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and KCNJ5

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_000881.3 Gene:KCNJ5 / 3762 HGNCID:6266 Length:419 Species:Homo sapiens


Alignment Length:370 Identity:114/370 - (30%)
Similarity:203/370 - (54%) Gaps:29/370 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AHDWAGSTIELTPDLGSGPRTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLME 149
            |.|:.....:.|..|..|         ::...|.|||:||.||....:.| ::||:.||.|||::
Human    29 ARDYVPIATDRTRLLAEG---------KKPRQRYMEKSGKCNVHHGNVQE-TYRYLSDLFTTLVD 83

  Fly   150 LEWKYMLTLFLGSYFLSWLLFAALCYVVAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIY 214
            |:|::.|.:|...|.::||.|..:.:::||..||  .|.|..:   |.: ||:..:..:|:..::
Human    84 LKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGD--LDHVGDQ---EWI-PCVENLSGFVSAFLF 142

  Fly   215 SVETQTTLGFGEKYASEECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAV 279
            |:||:||:|:|.:..:|:|||.|.|.::|.:..:::...||..::.|.::|.::...|.||:.||
Human   143 SIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAV 207

  Fly   280 ICYRDGRLCLLFRVCDPREQQSIESKIRVYIIVDKRTREGETI---KSHVELKLE-GNGEQIILW 340
            |..||.:|||:|||.|.|....:|:.||..:|..::|:|||.|   ::.:.:..: |:....::.
Human   208 ISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVS 272

  Fly   341 PDVVCHVIDETSPLSQFTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNI 405
            |.::.|.|::.||..:.:.|:| :..:||:.|.:.|...||....:|::||:..|:.||.||..:
Human   273 PLIISHEINQKSPFWEMSQAQL-HQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPV 336

  Fly   406 IHYDAQNERYIVDYENFNRTISVDMP------MTNPKNDHLKLEY 444
            :  ..:...|.|||..|:.|...:.|      :...|.:...|:|
Human   337 L--TLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQY 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 105/322 (33%)
KCNJ5NP_000881.3 IRK 54..193 CDD:366415 50/145 (34%)
Selectivity filter. /evidence=ECO:0000250 149..154 2/4 (50%)
IRK_C 200..371 CDD:375232 54/173 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.