DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and KCNJ2

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_000882.1 Gene:KCNJ2 / 3759 HGNCID:6263 Length:427 Species:Homo sapiens


Alignment Length:356 Identity:113/356 - (31%)
Similarity:198/356 - (55%) Gaps:26/356 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 STIELTPDLGSGPRTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYM 155
            :|:.:....|:|  .|.....::..:|.::|:|..||.|..:.||..||:.|:.||.:::.|::|
Human    22 ATMAVANGFGNG--KSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYLADIFTTCVDIRWRWM 84

  Fly   156 LTLFLGSYFLSWLLFAALCYVVAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQT 220
            |.:|..::.||||.|..:.:::|..|||     :...:.|:.   |:..|:|:.|..::|:||||
Human    85 LVIFCLAFVLSWLFFGCVFWLIALLHGD-----LDASKEGKA---CVSEVNSFTAAFLFSIETQT 141

  Fly   221 TLGFGEKYASEECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDG 285
            |:|:|.:..::|||..:|:.|.|.:...:|:..::..:.||.|:|.::...|.||..|||..|||
Human   142 TIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSHNAVIAMRDG 206

  Fly   286 RLCLLFRVCDPREQQSIESKIRVYIIVDKRTREGETIK-SHVELKL---EGNGEQIILWPDVVCH 346
            :|||::||.:.|:...:|:.:|..::..:.|.|||.|. ..:::.:   .|.....::.|..:.|
Human   207 KLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVH 271

  Fly   347 VIDETSPLSQFTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNII----H 407
            .|||.|||...:...:.| |.||:.|.:.|...|||..|:.::|||..||.||.|:..::    |
Human   272 EIDEDSPLYDLSKQDIDN-ADFEIVVILEGMVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKH 335

  Fly   408 YDAQNERYIVDYENFNRTISV-DMPMTNPKN 437
            |      |.|||..|::|..| :.|:.:.::
Human   336 Y------YKVDYSRFHKTYEVPNTPLCSARD 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 107/321 (33%)
KCNJ2NP_000882.1 IRK_N 1..47 CDD:400662 4/26 (15%)
IRK 48..186 CDD:395797 48/145 (33%)
Selectivity filter. /evidence=ECO:0000250 142..147 2/4 (50%)
IRK_C 193..366 CDD:407551 59/175 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 384..427
PDZ-binding. /evidence=ECO:0000255 425..427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.