DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and Kcnj16

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_445766.2 Gene:Kcnj16 / 29719 RGDID:61824 Length:419 Species:Rattus norvegicus


Alignment Length:325 Identity:104/325 - (32%)
Similarity:180/325 - (55%) Gaps:12/325 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYV 176
            ||:..|::.|:|..||.|:.|..:...||.|:.|||::.:|::|..:|..||.||||:|.::.::
  Rat    30 RRARRRLLHKDGSCNVYFKHIFGEWGSYMVDIFTTLVDTKWRHMFVIFSLSYILSWLIFGSIFWL 94

  Fly   177 VAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFV 241
            :|..|||.:.||        .:.||:..|||:.|..::|:|||||:|:|.:..:|||...:...:
  Rat    95 IALHHGDLLSDP--------DITPCVDNVHSFTAAFLFSLETQTTIGYGYRCVTEECSVAVLTVI 151

  Fly   242 MQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKI 306
            :|.:.:.:|...::....||.|...::...::||..|:|..|||:|||::|:.|.|....:|..:
  Rat   152 LQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTV 216

  Fly   307 RVYIIVDKRTREGETIKSHVELKLEGNGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAAQFELY 371
            |..::......||....:..:|||. |.:.|::.|..:.|.||..|||... ..|......||:.
  Rat   217 RAQLLRYSEDSEGRMTMAFKDLKLV-NDQIILVTPVTIVHEIDHESPLYAL-DRKAVAKDNFEIL 279

  Fly   372 VSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMPMTNPK 436
            |:.:.|..:|....::::||:||||.||.||.:::  :.:.:.|.|:...|..::.|..|..:.|
  Rat   280 VTFIYTGDSTGTSHQSRSSYVPREILWGHRFHDVL--EVKRKYYKVNCLQFEGSVEVYAPFCSAK 342

  Fly   437  436
              Rat   343  342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 99/312 (32%)
Kcnj16NP_445766.2 IRK 37..173 CDD:395797 49/143 (34%)
Selectivity filter. /evidence=ECO:0000250 131..136 2/4 (50%)
IRK_C 182..349 CDD:407551 51/165 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.