DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and Kcnj8

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_058795.3 Gene:Kcnj8 / 25472 RGDID:2960 Length:424 Species:Rattus norvegicus


Alignment Length:322 Identity:113/322 - (35%)
Similarity:181/322 - (56%) Gaps:12/322 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYVVAYSH 181
            |.:.|:|..|:..:.|.|:. |:::|:.|||::|:|::.|.:|..|:..||||||.:.::||::|
  Rat    35 RFIAKSGACNLAHKNIREQG-RFLQDIFTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAH 98

  Fly   182 GDFIFDPVSGKRMGEGVDP--CIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFVMQM 244
            ||.......|.....|::.  |:..|.|:.:..::|:|.|.|:|||.:..:||||..|.:.::|.
  Rat    99 GDIYAYMEKGITEKSGLESAVCVTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQN 163

  Fly   245 LSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKIRVY 309
            :...:|...|:..|:.|||:..|:...|.||..|||..|:|:||.:|||.|.|:...|.:.:|:.
  Rat   164 IVGLIINAVMLGCIFMKTAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQ 228

  Fly   310 IIVDKRTREGETIKSH-----VELKLEGNGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAAQFE 369
            ::....|.|||.:..|     |:..:|.|...::. |.::|||||:.|||...:...|.| ...|
  Rat   229 VVKKTTTPEGEVVPIHQQDIPVDNPIESNNIFLVA-PLIICHVIDKRSPLYDISATDLVN-QDLE 291

  Fly   370 LYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMP 431
            :.|.:.|....|...|:|:|||:..||.||.|||:|:  ..:...|.|||..|..|:.|..|
  Rat   292 VIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIV--TEEEGVYSVDYSKFGNTVRVAAP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 112/320 (35%)
Kcnj8NP_058795.3 IRK 37..370 CDD:279361 112/320 (35%)
Selectivity filter. /evidence=ECO:0000250 140..145 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.