DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and Kcnj1

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_058719.2 Gene:Kcnj1 / 24521 RGDID:2957 Length:391 Species:Rattus norvegicus


Alignment Length:346 Identity:111/346 - (32%)
Similarity:187/346 - (54%) Gaps:21/346 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GLRRSLNRVMEKNGKENVVFRRIPEKS-WRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAAL 173
            |..|...|::.|.|:.|:.|..:..:| :.:..|:.||:::|:|:|.:|:|:.::..||.||..|
  Rat    34 GRSRQRARLVSKEGRCNIEFGNVDAQSRFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLL 98

  Fly   174 CYVVAYSHGDF--IFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPET 236
            .|||||.|.|.  .:.|       :...||:..::...:..::|:|||.|:|:|.::.:|:|...
  Rat    99 WYVVAYVHKDLPEFYPP-------DNRTPCVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATA 156

  Fly   237 IFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQS 301
            |||.:.|.:...:|...|...|.||.:||.::...:.||..|||..|.|:||||.||.:.|:...
  Rat   157 IFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLL 221

  Fly   302 IESKIRVYIIVDKRTREGETI---KSHVELKLE-GNGEQIILWPDVVCHVIDETSPLSQFTTAKL 362
            |.|.|...::....|.|||||   ::::...:: ||.....:.|..:.|:||..||.... .|:.
  Rat   222 IGSHIYGKLLKTTITPEGETIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHM-AAET 285

  Fly   363 FNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTIS 427
            .:...|||.|.:.||..:|:...:.:|||:|.|:.||.|||.|:. ..:..:|.||:.||.:|:.
  Rat   286 LSQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFVPIVS-KTKEGKYRVDFHNFGKTVE 349

  Fly   428 VDMP-----MTNPKNDHLKLE 443
            |:.|     :.|.|:...:::
  Rat   350 VETPHCAMCLYNEKDARARMK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 106/324 (33%)
Kcnj1NP_058719.2 IRK 43..371 CDD:279361 108/337 (32%)
Selectivity filter. /evidence=ECO:0000250 141..146 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.