DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and Kcnj6

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_034736.2 Gene:Kcnj6 / 16522 MGIID:104781 Length:425 Species:Mus musculus


Alignment Length:368 Identity:114/368 - (30%)
Similarity:198/368 - (53%) Gaps:39/368 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PRTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSW 167
            ||..|.|..:|.:.|.:.|:||.||....:.| ::||:.|:.|||::|:|::.|.:|:..|.::|
Mouse    43 PRHISRDRTKRKIQRYVRKDGKCNVHHGNVRE-TYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTW 106

  Fly   168 LLFAALCYVVAYSHGDF--IFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYAS 230
            |.|..:.:::||..||.  |.||        ...||:..::.:|:..::|:||:||:|:|.:..:
Mouse   107 LFFGMIWWLIAYIRGDMDHIEDP--------SWTPCVTNLNGFVSAFLFSIETETTIGYGYRVIT 163

  Fly   231 EECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCD 295
            ::|||.|.|.::|.:..:::...||..::.|.::|.::...|.||..|||..|||:|||:|||.|
Mouse   164 DKCPEGIILLLIQSVLGSIVNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGD 228

  Fly   296 PREQQSIESKIRVYIIVDKRTREGETIK-SHVELKL---EGNGEQIILWPDVVCHVIDETSPLSQ 356
            .|....:|:.||..:|..|:|.|||.|. :..::.:   .|:....::.|.::.|.|::.||..:
Mouse   229 LRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWE 293

  Fly   357 FTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYEN 421
            .:.|:| ...:.|:.|.:.|...||....:|::||:..||.||.||..::  ..::..|.|||.:
Mouse   294 ISKAQL-PKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVL--TLEDGFYEVDYNS 355

  Fly   422 FNRTISVDMPMTNPK---------------------NDHLKLE 443
            |:.|.....|..:.|                     |.|.:||
Mouse   356 FHETYETSTPSLSAKELAELANRAELPLSWSVSSKLNQHAELE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 102/318 (32%)
Kcnj6NP_034736.2 IRK 59..198 CDD:395797 46/147 (31%)
Selectivity filter. /evidence=ECO:0000250 154..159 2/4 (50%)
IRK_C 205..374 CDD:407551 57/171 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..425 4/7 (57%)
PDZ-binding 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.