DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and Kcnj12

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_017452453.1 Gene:Kcnj12 / 117052 RGDID:621660 Length:529 Species:Rattus norvegicus


Alignment Length:456 Identity:145/456 - (31%)
Similarity:229/456 - (50%) Gaps:59/456 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 STSMPVKPKPLEQKPLL----RSSEKETVNASDYYPESPGFVRRRRSKAAGDHLETRSEQNPTFS 81
            |..:...|:.|....|.    :|.|.....:|...|..|   :.|:..|:....:......|..|
  Rat    17 SWDLAASPRRLSTPTLATFPWKSQEPGAEMSSQNSPRVP---QPRQPSASWPRQKQHPPLQPRAS 78

  Fly    82 FPYAHDWAGSTIELTPDLGSGPR----------------TSSSDGL------------------- 111
            ...||:.....:.|  ..|.||.                :|..|||                   
  Rat    79 ATKAHEVPPPGVSL--GAGQGPPDPGMTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTR 141

  Fly   112 RRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYV 176
            ||..||.::|||:.|:.|..:.|||.||:.|:.||.:::.|:|||.:|..::..|||||..:.:|
  Rat   142 RRCRNRFVKKNGQCNIEFANMDEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWV 206

  Fly   177 VAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFV 241
            :|.:|||  .:|..|:    |..||:..||.::|..::|:|||||:|:|.:..:||||..:|:.|
  Rat   207 IAVAHGD--LEPAEGR----GRTPCVLQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVV 265

  Fly   242 MQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKI 306
            .|.:...:|:..|:..|.||.|||.::...|.||..||:..|||:|||::||.:.|:...:|:.:
  Rat   266 AQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHV 330

  Fly   307 RVYIIVDKRTREGETIK-SHVELKL---EGNGEQIILWPDVVCHVIDETSPLSQFTTAKLFNAAQ 367
            |..:|..:.|.|||.|. ..:::.:   :|.....::.|..:.|.|||.|||...:...| ....
  Rat   331 RAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDL-ETDD 394

  Fly   368 FELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMPM 432
            ||:.|.:.|...|||..|:|::|||..||.||.||..:: ::.:|: |.:||.:|::|..|  |.
  Rat   395 FEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVL-FEEKNQ-YKIDYSHFHKTYEV--PS 455

  Fly   433 T 433
            |
  Rat   456 T 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 116/316 (37%)
Kcnj12XP_017452453.1 IRK_N 105..148 CDD:285640 7/42 (17%)
IRK 149..476 CDD:279361 118/319 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.