DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj2

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_004916397.1 Gene:kcnj2 / 100497641 XenbaseID:XB-GENE-1012188 Length:425 Species:Xenopus tropicalis


Alignment Length:333 Identity:112/333 - (33%)
Similarity:189/333 - (56%) Gaps:15/333 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GSGPRTSSSDGLRRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYF 164
            |.|...|.....::..:|.::|:|..||.|..:.||..||:.|:.||.:::.|::||.:|..::.
 Frog    29 GYGNGKSKIHTRQQCRSRFVKKDGHCNVQFINVSEKGQRYLSDIFTTCVDIRWRWMLVIFCLAFI 93

  Fly   165 LSWLLFAALCYVVAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYA 229
            ||||.|..:.:::|..|.| :..|.|.|       ||:..|.|:.|..::|:|||||:|:|.:..
 Frog    94 LSWLFFGCVFWLIALLHED-LGAPESHK-------PCVTQVSSFTAAFLFSIETQTTIGYGFRCV 150

  Fly   230 SEECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVC 294
            ::|||..:|:.|.|.:...:|:..::..:.||.|:|.::...|.|||.|||..|||:|||::||.
 Frog   151 TDECPIAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKRNETLVFSDNAVIAMRDGKLCLMWRVG 215

  Fly   295 DPREQQSIESKIRVYIIVDKRTREGETIK-SHVELKL---EGNGEQIILWPDVVCHVIDETSPLS 355
            :.|:...:|:.:|..::..:.|.|||.|. ..:::.:   .|.....::.|..:.|.|:|.|||.
 Frog   216 NLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQIDINVGFDSGIDRIFLVSPITIVHEINEESPLY 280

  Fly   356 QFTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYE 420
            ..:...|.| :.||:.|.:.|...|||..|:.::|||..||.||.|:..:: ::.:| .|.|||.
 Frog   281 DLSKQDLDN-SDFEIVVILEGMVEATAMTTQCRSSYLASEILWGHRYEPVL-FEERN-YYKVDYS 342

  Fly   421 NFNRTISV 428
            .|::|..|
 Frog   343 RFHKTYEV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 108/314 (34%)
kcnj2XP_004916397.1 IRK_N 1..47 CDD:369890 3/17 (18%)
IRK 48..186 CDD:366415 50/145 (34%)
IRK_C 193..366 CDD:375232 57/161 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.