DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj15

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_004919636.1 Gene:kcnj15 / 100486399 XenbaseID:XB-GENE-5794036 Length:377 Species:Xenopus tropicalis


Alignment Length:338 Identity:111/338 - (32%)
Similarity:194/338 - (57%) Gaps:16/338 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYVVAYSH 181
            ||:.|:|..||...::......|::||.||:::::|:|.||||..::||:|..|..:.:|||:.|
 Frog    36 RVISKSGHSNVKIDKVEGVFLLYLQDLWTTVIDMKWRYKLTLFAATFFLTWCFFGVIYFVVAFIH 100

  Fly   182 GDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFVMQMLS 246
            ||...:|:|..      .||:..|.|:....::|:|:|||:|:|.::.:||||..||:.|.|::.
 Frog   101 GDMNIEPLSNH------TPCVMNVDSFTGAFLFSMESQTTIGYGFRFITEECPLAIFMLVAQLVV 159

  Fly   247 AALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKIRVYII 311
            ..|||..:.....||.|||.::...:|||:||||...:|:|||:.:|.:.|:...|:.::...::
 Frog   160 TTLIEIFITGTFLAKIARPKKRAETIKFSNKAVITKHNGKLCLVVQVANMRKSLLIQCQLYGKLL 224

  Fly   312 VDKRTREGETI---KSHVELKLEGNGEQ-IILWPDVVCHVIDETSPLSQFTTAKLFNAAQFELYV 372
            ....|:|||.|   :.::...::.:.|. .::.|....||:|:.|||... ||.......|||.|
 Frog   225 HSYETKEGEKILLQQVNMNFNVDSSSESPFLILPLTFYHVLDDNSPLKDL-TADNIKTKDFELVV 288

  Fly   373 SIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNR----TISVDMPMT 433
            .:..|..:|:.:.:::|||||.||:||..||.::....|. :|:.|:.||::    .:...:.:.
 Frog   289 LLNATVESTSTVCQSRTSYLPDEIYWGYEFVPVVSLSPQG-KYVADFSNFDKIRKCKVIETIYLV 352

  Fly   434 NPKNDHLKLEYRK 446
            |.:...|:.:||:
 Frog   353 NFEKRKLEEKYRQ 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 105/320 (33%)
kcnj15XP_004919636.1 IRK 38..178 CDD:366415 52/145 (36%)
IRK_C 185..342 CDD:375232 51/158 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.