DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj3

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_002936698.1 Gene:kcnj3 / 100380084 XenbaseID:XB-GENE-1004371 Length:489 Species:Xenopus tropicalis


Alignment Length:364 Identity:111/364 - (30%)
Similarity:195/364 - (53%) Gaps:36/364 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TSSSDGL-------RRSLNRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGS 162
            |:||.|.       :|...|.:||||:.||....:..::.||:.||.|||::|:|::.|.:|:.:
 Frog    16 TTSSSGSGFNQAAPKRKRQRFVEKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILT 80

  Fly   163 YFLSWLLFAALCYVVAYSHGDFIFDPVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEK 227
            |.::||..|::.:|:||..||.      .|...|...||:..|:::.:..::.:||:.|:|:|.:
 Frog    81 YTVAWLFMASMWWVIAYMRGDL------NKAHDENYTPCVANVYNFPSAFLFFIETEATIGYGFR 139

  Fly   228 YASEECPETIFLFVMQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFR 292
            |.:::|||.|.||:.|.:..::::..::..::.|.::|.::...|.||:.|||..|||:|.|:||
 Frog   140 YITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFR 204

  Fly   293 VCDPREQQSIESKIRVYIIVDKRTREGETIK-SHVELKL---EGNGEQIILWPDVVCHVIDETSP 353
            |.:.|....:.::||..::..::|.|||.:. ..:||.:   .|..:..::.|..:|||||..||
 Frog   205 VGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDTKSP 269

  Fly   354 LSQFTTAKLFNAAQFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVD 418
            ..:.:...: ...|||:.|.:.|....|....:|:|||...|:.||.||..:|  ..:...:.||
 Frog   270 FYELSQRSM-QTEQFEIVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVI--SLEEGFFKVD 331

  Fly   419 YENFNRTISV-----------DM-----PMTNPKNDHLK 441
            |..|:.|..|           ||     |:..|...::|
 Frog   332 YSQFHATFEVPTAPYSVKEQEDMLLMSSPLIAPAVSNIK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 102/332 (31%)
kcnj3XP_002936698.1 IRK 37..354 CDD:279361 100/325 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.