DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk3 and kcnj13

DIOPT Version :9

Sequence 1:NP_001137835.2 Gene:Irk3 / 35131 FlyBaseID:FBgn0032706 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001096437.1 Gene:kcnj13 / 100125048 XenbaseID:XB-GENE-983214 Length:374 Species:Xenopus tropicalis


Alignment Length:340 Identity:99/340 - (29%)
Similarity:169/340 - (49%) Gaps:27/340 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 NRVMEKNGKENVVFRRIPEKSWRYMRDLVTTLMELEWKYMLTLFLGSYFLSWLLFAALCYVVAYS 180
            :|::.|:|...|...|:..:...|:||:...|:::.|::|:..|..|:...|||||...|::|..
 Frog    28 HRLVTKDGHSMVKAGRMQGQGLTYLRDIWGLLLDMRWRWMMLAFSASFLAHWLLFAVFWYLLAEM 92

  Fly   181 HGDFIFD----PVSGKRMGEGVDPCIYGVHSWVAMIIYSVETQTTLGFGEKYASEECPETIFLFV 241
            :||...|    |       |....|:..:.|:.|...:|:|||.|:|:|..:.|.:||..|.|..
 Frog    93 NGDLAVDHDAPP-------ENHTICVKYITSFTAAFSFSLETQLTIGYGTMFPSGDCPSAIALLA 150

  Fly   242 MQMLSAALIEGCMVSVIYAKTARPARQLTKLKFSDKAVICYRDGRLCLLFRVCDPREQQSIESKI 306
            :|||...::|..:..|..||.|||..:...::||..||:...:|:.||:|:|.:.|  .|..:.:
 Frog   151 VQMLLGLMLEAFITGVFVAKIARPKNRTPSIRFSRLAVVGSPEGKPCLMFQVANTR--SSPLTMV 213

  Fly   307 RVYIIVDKRTREGETIKSHVELKLEGNGE----QIILWPDVVCHVIDETSPLSQFTTAKLFNAA- 366
            :|..|:.:...:|:..:::||..|:....    ....:|....|.:...||||.....:|.::| 
 Frog   214 KVSGILYQERGDGQIQQANVEFSLDSQASGAECPFFTFPLTYSHSLCSGSPLSVLLQRELLSSAG 278

  Fly   367 QFELYVSIVGTSPATAQMTEAKTSYLPREIFWGQRFVNIIHYDAQNERYIVDYENFNRTISVDMP 431
            ..||.|.:..|..::.::.:.:|||||.||..|.||...:....:. .|.:..|:|.|      |
 Frog   279 HLELVVCLSATQESSGEICQCRTSYLPSEILQGHRFAPCLTRRLEG-GYRICMESFGR------P 336

  Fly   432 MTN-PKNDHLKLEYR 445
            :.. |:..|.:| ||
 Frog   337 LPELPQPSHRQL-YR 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk3NP_001137835.2 Ion_trans_2 119..432 CDD:304432 92/321 (29%)
kcnj13NP_001096437.1 Ion_trans_2 31..174 CDD:389812 47/149 (32%)
IRK_C 181..348 CDD:375232 46/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D956263at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.