DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Faf2 and AT4G23040

DIOPT Version :9

Sequence 1:NP_001286057.1 Gene:Faf2 / 35129 FlyBaseID:FBgn0025608 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_567675.1 Gene:AT4G23040 / 828403 AraportID:AT4G23040 Length:525 Species:Arabidopsis thaliana


Alignment Length:167 Identity:52/167 - (31%)
Similarity:83/167 - (49%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 LRRQQDEAYEQSLLADEEKERQRQRERDAVR-----QAEEAVEQARRDVELRKEEIARQKIELAT 359
            :|.|||:.|..||.||..|...|:.|.:|.|     :|:...|:|||.|| .::|:.||.:....
plant   371 IREQQDDEYLASLEADRVKAEARRLEEEAARVEAIEEAKRKEEEARRKVE-EEQELERQLVSKEA 434

  Fly   360 LVPSEPAADAVGAIAVVFKLPSGTRLERRFNQTDSVLDVYHYL-FCHPDSPDEFEITTNFPKRVL 423
            .:|.||.|....||.:..:||.|||..|||.::|.:..::.:: .|....|:.:.:...:|:|..
plant   435 SLPQEPPAGEENAITLQVRLPDGTRHGRRFFKSDKLQSLFDFIDICRVVKPNTYRLVRPYPRRAF 499

  Fly   424 FSKANLDAAGETGTAKETLTKTLQAVGLKNR-EVLFV 459
                   ..||       .:.||..:||.:: |.||:
plant   500 -------GDGE-------CSSTLNDIGLTSKQEALFL 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Faf2NP_001286057.1 UBA_FAF2 12..49 CDD:270597
UAS_ETEA 163..280 CDD:239289
ATP-synt_B <287..>373 CDD:304375 28/77 (36%)
UBQ 373..462 CDD:294102 23/89 (26%)
AT4G23040NP_567675.1 UBA_Ubx1_like 6..42 CDD:270536
UBX 444..524 CDD:395637 24/93 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.