Sequence 1: | NP_001286057.1 | Gene: | Faf2 / 35129 | FlyBaseID: | FBgn0025608 | Length: | 464 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001022300.1 | Gene: | ubxn-5 / 3565635 | WormBaseID: | WBGene00011336 | Length: | 174 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 50/198 - (25%) |
---|---|---|---|
Similarity: | 86/198 - (43%) | Gaps: | 43/198 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 277 TNANEVWLSQARADRLERNFTQTLRRQQDEAYEQSLLADEEKERQRQRERDAVR-QAEEAVEQAR 340
Fly 341 RDVELRKEEIARQKIELATLVPSEPAADAVGAIAVVFKLPSGTRLERRFNQTDSVLDVYHYLFCH 405
Fly 406 PDSPDEFEITTNFPK----------RVLFSKANLDAA--GETGTAKET-LTKTLQAVGLKNREVL 457
Fly 458 FVN 460 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Faf2 | NP_001286057.1 | UBA_FAF2 | 12..49 | CDD:270597 | |
UAS_ETEA | 163..280 | CDD:239289 | 2/2 (100%) | ||
ATP-synt_B | <287..>373 | CDD:304375 | 23/86 (27%) | ||
UBQ | 373..462 | CDD:294102 | 23/101 (23%) | ||
ubxn-5 | NP_001022300.1 | UBQ | 74..>125 | CDD:320785 | 10/50 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_102329 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |