DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Faf2 and ubxn-5

DIOPT Version :9

Sequence 1:NP_001286057.1 Gene:Faf2 / 35129 FlyBaseID:FBgn0025608 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001022300.1 Gene:ubxn-5 / 3565635 WormBaseID:WBGene00011336 Length:174 Species:Caenorhabditis elegans


Alignment Length:198 Identity:50/198 - (25%)
Similarity:86/198 - (43%) Gaps:43/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 TNANEVWLSQARADRLERNFTQTLRRQQDEAYEQSLLADEEKERQRQRERDAVR-QAEEAVEQAR 340
            || |.|...:...||       .|..||::.|.:||..|..|    :.|:|.:| :||:.     
 Worm     3 TN-NHVQKEKFAEDR-------ALLSQQNKEYAESLAKDIAK----KEEKDKIRFEAEQK----- 50

  Fly   341 RDVELRKEEIARQKIELATLVPSEPAADAVGAIAVVFKLPSGTRLERRFNQTDSVLDVYHYLFCH 405
               ||||:.|...:.:|...|       :.|.:.::.:.|:|:||...|:.:..:..::..:..:
 Worm    51 ---ELRKKTIQDYREKLKGTV-------SQGPLRLLVRYPNGSRLILSFSPSQPMTSLFDAIILN 105

  Fly   406 PDSPDEFEITTNFPK----------RVLFSKANLDAA--GETGTAKET-LTKTLQAVGLKNREVL 457
            |..||.|.:.:.:|:          ..:|:....|..  |....|||| ..|.|:.:  .|..:|
 Worm   106 PACPDYFSVRSVYPRAEIHCYPAWYHTIFNAEFKDETEKGANNVAKETNEVKCLETI--PNNSIL 168

  Fly   458 FVN 460
            :||
 Worm   169 YVN 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Faf2NP_001286057.1 UBA_FAF2 12..49 CDD:270597
UAS_ETEA 163..280 CDD:239289 2/2 (100%)
ATP-synt_B <287..>373 CDD:304375 23/86 (27%)
UBQ 373..462 CDD:294102 23/101 (23%)
ubxn-5NP_001022300.1 UBQ 74..>125 CDD:320785 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102329
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.