DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Faf2 and Ubxn8

DIOPT Version :9

Sequence 1:NP_001286057.1 Gene:Faf2 / 35129 FlyBaseID:FBgn0025608 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_848763.2 Gene:Ubxn8 / 108159 MGIID:1337129 Length:277 Species:Mus musculus


Alignment Length:218 Identity:46/218 - (21%)
Similarity:81/218 - (37%) Gaps:51/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 RMMIVGRFEGDCTPEELLRRLQSVTNANEVWLSQARADRLERNFTQ-------------TLRRQQ 304
            |..:|...:.:...|:..|.:::|....:    :.:..:||..|.|             .|...:
Mouse    79 RRRLVRERQQE
AQGEKASRYIENVLKPQQ----EMKLKKLEERFYQMTGETWKLTAGHRLLEGDE 139

  Fly   305 DEAYEQSLLADEEKERQRQRERDAVRQAEEAVEQARRDVELRKEEIARQKIELATLVPSEPAADA 369
            |..:|.|..|..|........|..:.:....:..|.|.: ||||         ...:|.||:..|
Mouse   140 DSEFENSSQASFETINGEAARRQNLPKFSTEISPAARPL-LRKE---------VPDLPEEPSETA 194

  Fly   370 VGAIAVVFKLPSGTRLERRFNQT-------DSVLDV-YHYLFCHPDSPDEFEITTNFPKRVLFSK 426
            ...:.|..:.|:|..|.|||.::       |.::.| ||        ...:.::.:||:|.|   
Mouse   195 EEVVTVALRCPNGRVLRRRFFKSWNSQVLLDWMMKVGYH--------KSLYRLSNSFPRRAL--- 248

  Fly   427 ANLDAAGETGTAKETLTKTLQAV 449
                 ..|.|::.|.:..|:..|
Mouse   249 -----EVEGGSSLEDIGITVDTV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Faf2NP_001286057.1 UBA_FAF2 12..49 CDD:270597
UAS_ETEA 163..280 CDD:239289 5/26 (19%)
ATP-synt_B <287..>373 CDD:304375 21/98 (21%)
UBQ 373..462 CDD:294102 20/85 (24%)
Ubxn8NP_848763.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..89 2/9 (22%)
UBQ 192..271 CDD:294102 21/91 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831616
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.