DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jwa and PRA1.A2

DIOPT Version :9

Sequence 1:NP_609901.5 Gene:Jwa / 35128 FlyBaseID:FBgn0032704 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_850778.1 Gene:PRA1.A2 / 830485 AraportID:AT5G05987 Length:209 Species:Arabidopsis thaliana


Alignment Length:183 Identity:45/183 - (24%)
Similarity:82/183 - (44%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PLRTLDDFILGSARFQLPNLKDFEKWGNRVVKNLLYYQTNYFLLFITIYVLMIFFNPSKIITGLL 129
            |.|:..:|.   :||..|  :.|.||.:|:..||.||:||||:|.|.:..|.:...|..:: |..
plant    23 PPRSFGEFF---SRFAFP--RSFSKWKSRLKCNLYYYRTNYFILVIFVLGLALVTRPLALV-GAA 81

  Fly   130 VQALIIGVIWQFFSGKSKKNFI----------ASRL-------TGGNANAAEQ---NAQQKWYIL 174
            :.||.|..:...|:....:.||          |:::       ..|.:.|.:.   ..:.:|..:
plant    82 LTALSIAFLNDSFAASFNEKFIRTIRHFSPHMAAKMRPPHMPVIRGRSTARKTVYVCGKPRWVFV 146

  Fly   175 AGALLGGYLLLHLLSAVLLTIFTVLLPISLTFIHASLRLRNIKNKLTNSIESF 227
            ...|....::......:|..::.:|..:::..:|||:|..|:|.:|....|.|
plant   147 ITFLTASLVMWFSSCGLLWVLYALLTSLAVIIVHASIRTPNLKARLNTFREEF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JwaNP_609901.5 PRA1 62..220 CDD:281235 42/174 (24%)
PRA1.A2NP_850778.1 PRA1 20..192 CDD:397359 42/174 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I4105
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2578
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1288023at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12859
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.