DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jwa and Arl6ip5

DIOPT Version :9

Sequence 1:NP_609901.5 Gene:Jwa / 35128 FlyBaseID:FBgn0032704 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_076462.1 Gene:Arl6ip5 / 66028 RGDID:708572 Length:188 Species:Rattus norvegicus


Alignment Length:194 Identity:68/194 - (35%)
Similarity:105/194 - (54%) Gaps:25/194 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NLQLPPLRTLDDFILGSARFQLPNLKDFEKWGNRVVKNLLYYQTNYFLLFITIYVLMIFFNP-SK 123
            ::.|.|||..|||..||.||..|:.:|..||.||||.|||||||||.::...:..::.|.:| :.
  Rat     2 DVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFLSPFNM 66

  Fly   124 IITGLLVQALIIGVIWQFFS----GKSKKNFIASRLTGGNANAAEQNAQQKWYILAGALLGGYLL 184
            |:.|::|..:..|.:|...:    .:.||.:..:                  :::. .:|..|.|
  Rat    67 ILGGIIVVLVFTGFVWAAHNKDILRRMKKQYPTA------------------FVMV-VMLASYFL 112

  Fly   185 LHLLSAVLLTIFTVLLPISLTFIHASLRLRNIKNKLTNSIESFA-PSTPMGSLLDALNVRAEGV 247
            :.:...|::.:|.:..|:.|.||||||||||:||||.|.:|... ..||||.:||||..:.:.:
  Rat   113 ISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDSI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JwaNP_609901.5 PRA1 62..220 CDD:281235 56/162 (35%)
Arl6ip5NP_076462.1 PRA1 3..148 CDD:397359 56/163 (34%)
Required for homodimer formation and heterodimer formation with ARL6IP1. /evidence=ECO:0000250|UniProtKB:Q8R5J9 103..117 3/14 (21%)
Targeting to endoplasmic reticulum membrane. /evidence=ECO:0000269|PubMed:11096102 136..188 22/41 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343257
Domainoid 1 1.000 104 1.000 Domainoid score I6555
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4673
Inparanoid 1 1.050 121 1.000 Inparanoid score I4660
OMA 1 1.010 - - QHG49062
OrthoDB 1 1.010 - - D1288023at2759
OrthoFinder 1 1.000 - - FOG0003654
OrthoInspector 1 1.000 - - otm46087
orthoMCL 1 0.900 - - OOG6_105959
Panther 1 1.100 - - O PTHR12859
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2527
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.