DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jwa and Arl6ip5

DIOPT Version :9

Sequence 1:NP_609901.5 Gene:Jwa / 35128 FlyBaseID:FBgn0032704 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_075368.1 Gene:Arl6ip5 / 65106 MGIID:1929501 Length:188 Species:Mus musculus


Alignment Length:194 Identity:69/194 - (35%)
Similarity:107/194 - (55%) Gaps:25/194 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NLQLPPLRTLDDFILGSARFQLPNLKDFEKWGNRVVKNLLYYQTNYFLLFITIYVLMIFFNP-SK 123
            ::.|.|||..|||..||.||..|:.:|..||.||||.|||||||||.::...:..::.|.:| :.
Mouse     2 DVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFLSPFNM 66

  Fly   124 IITGLLVQALIIGVIWQFFS----GKSKKNFIASRLTGGNANAAEQNAQQKWYILAGALLGGYLL 184
            |:.|::|..:.:|.:|...:    .:.||.:..:                  :::. .:|..|.|
Mouse    67 ILGGVIVVLVFMGFVWAAHNKDILRRMKKQYPTA------------------FVMV-VMLASYFL 112

  Fly   185 LHLLSAVLLTIFTVLLPISLTFIHASLRLRNIKNKLTNSIESFA-PSTPMGSLLDALNVRAEGV 247
            :.:...|::.:|.:.||:.|.||||||||||:||||.|.:|... ..||||.:||||..:.:.:
Mouse   113 ISMFGGVMVFVFGITLPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDNI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JwaNP_609901.5 PRA1 62..220 CDD:281235 57/162 (35%)
Arl6ip5NP_075368.1 PRA1 5..148 CDD:281235 57/161 (35%)
Required for homodimer formation and heterodimer formation with ARL6IP1. /evidence=ECO:0000269|PubMed:18684713 103..117 3/14 (21%)
Targeting to endoplasmic reticulum membrane. /evidence=ECO:0000250|UniProtKB:Q9ES40 136..188 22/41 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839440
Domainoid 1 1.000 106 1.000 Domainoid score I6580
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4673
Inparanoid 1 1.050 123 1.000 Inparanoid score I4712
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49062
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003654
OrthoInspector 1 1.000 - - otm43998
orthoMCL 1 0.900 - - OOG6_105959
Panther 1 1.100 - - O PTHR12859
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3380
SonicParanoid 1 1.000 - - X2527
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.