DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jwa and arl6ip5a

DIOPT Version :9

Sequence 1:NP_609901.5 Gene:Jwa / 35128 FlyBaseID:FBgn0032704 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001006096.1 Gene:arl6ip5a / 450076 ZFINID:ZDB-GENE-031113-22 Length:190 Species:Danio rerio


Alignment Length:194 Identity:75/194 - (38%)
Similarity:114/194 - (58%) Gaps:24/194 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LQLPPLRTLDDFILGSARFQLPNLKDFEKWGNRVVKNLLYYQTNYFLLFITIYVLMIFFNPSKII 125
            :::.|||..|||..||.||..|:.:|..||.||||.|||||||||.::.|.:::::.|.||..:.
Zfish     4 VEIAPLRGWDDFYPGSDRFGKPDTRDLAKWNNRVVSNLLYYQTNYLVVAILVFLVVGFLNPVSMF 68

  Fly   126 TG-LLVQALIIGVIWQFFSGKSK---KNFIASRLTGGNANAAEQNAQQKWYILAGALLGGYLLLH 186
            || ::|.::.||.:|   :|::|   |.|            .::|.....:::   ::..|.|:.
Zfish    69 TGAVVVASVFIGSVW---AGENKAIIKKF------------KKENPSLFVFLV---MVVSYFLMS 115

  Fly   187 LLSAVLLTIFTVLLPISLTFIHASLRLRNIKNKLTNSIESFA-PSTPMGSLLDALNVRAEGVFN 249
            |...|::.:..:.||:.|.|.|||||||||||||.|.:||.. ..:|||.:|:||..:.|. ||
Zfish   116 LFGGVMVFLLGIKLPLLLIFAHASLRLRNIKNKLENKMESAGLKKSPMGIILEALGQQEEN-FN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JwaNP_609901.5 PRA1 62..220 CDD:281235 61/161 (38%)
arl6ip5aNP_001006096.1 PRA1 5..149 CDD:281235 61/161 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583564
Domainoid 1 1.000 108 1.000 Domainoid score I6370
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4673
Inparanoid 1 1.050 125 1.000 Inparanoid score I4680
OMA 1 1.010 - - QHG49062
OrthoDB 1 1.010 - - D1288023at2759
OrthoFinder 1 1.000 - - FOG0003654
OrthoInspector 1 1.000 - - otm25919
orthoMCL 1 0.900 - - OOG6_105959
Panther 1 1.100 - - O PTHR12859
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3380
SonicParanoid 1 1.000 - - X2527
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.