DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jwa and praf-3

DIOPT Version :9

Sequence 1:NP_609901.5 Gene:Jwa / 35128 FlyBaseID:FBgn0032704 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001023104.1 Gene:praf-3 / 177637 WormBaseID:WBGene00017070 Length:186 Species:Caenorhabditis elegans


Alignment Length:204 Identity:66/204 - (32%)
Similarity:103/204 - (50%) Gaps:22/204 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 MTTPSTSVGDAAAALSGNLQLPPLRTLDDFILGSARFQLPNLKDFEKWGNRVVKNLLYYQTNYFL 107
            |||.|.::     .:...:::||.|...:|:|.:.|::.|...||:||.||::.||||:|||||:
 Worm     1 MTTSSENM-----QIMNGVEVPPFRNFHEFLLETDRYERPPFNDFKKWNNRIISNLLYFQTNYFV 60

  Fly   108 LFITIYVLMIFFNPSKIITGLLVQALIIGVIWQFFSGKSKKNFIASRLTGGNANAAEQNAQQKWY 172
            ..||:::|..|.:...|..||:....:|..:  .|:            ...:||..:........
 Worm    61 TIITLFLLHTFISSQDIFVGLIAVVAVIATL--IFA------------VSADANIKKMRTDHPLV 111

  Fly   173 ILAGALLGGYLLLHLLSAVLLTIFTVLLPISLTFIHASLRLRNIKNKLTNSIESFAPSTP-MGSL 236
            .|.|.:|..|..:.:..:||:..|.:|.|:.|..:|||||||.|.|:..|..|.....|. ||.:
 Worm   112 TLGGIILVAYFFISVFQSVLVVAFALLFPVFLVLVHASLRLRGIANRAANVKEQLGIRTSVMGQI 176

  Fly   237 LD--ALNVR 243
            ||  .|||:
 Worm   177 LDRTGLNVK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JwaNP_609901.5 PRA1 62..220 CDD:281235 52/157 (33%)
praf-3NP_001023104.1 PRA1 15..158 CDD:281235 51/156 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160743
Domainoid 1 1.000 106 1.000 Domainoid score I4112
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4673
Inparanoid 1 1.050 115 1.000 Inparanoid score I3396
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49062
OrthoDB 1 1.010 - - D1288023at2759
OrthoFinder 1 1.000 - - FOG0003654
OrthoInspector 1 1.000 - - oto19871
orthoMCL 1 0.900 - - OOG6_105959
Panther 1 1.100 - - LDO PTHR12859
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3380
SonicParanoid 1 1.000 - - X2527
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.