DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jwa and PRAF2

DIOPT Version :9

Sequence 1:NP_609901.5 Gene:Jwa / 35128 FlyBaseID:FBgn0032704 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_009144.1 Gene:PRAF2 / 11230 HGNCID:28911 Length:178 Species:Homo sapiens


Alignment Length:194 Identity:75/194 - (38%)
Similarity:98/194 - (50%) Gaps:31/194 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LQLPPLRTLDDFILGSARFQLPNLKDFEKWGNRVVKNLLYYQTNYFLLFITIYVLMIFFNPSKII 125
            ::|||||.||||:|||||...|:..|.::|.:||:.|||||||||.|.|.....|..:..|...:
Human     4 VRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTL 68

  Fly   126 TGLLVQALIIGV-IWQFFSGKSKKNFIASRLTGGNANAAEQNA-------QQKWYILAGALLGGY 182
            ...||.|:.:|| :|                      |||..|       ......||..|..|.
Human    69 LSALVVAVALGVLVW----------------------AAETRAAVRRCRRSHPAACLAAVLAVGL 111

  Fly   183 LLLHLLSAVLLTIFTVLLPISLTFIHASLRLRNIKNKLTNSIESFA-PSTPMGSLLDALNVRAE 245
            |:|.:.......:|::..|:.|..:||||||||:|||:.|.|||.. ..||||.||:||....|
Human   112 LVLWVAGGACTFLFSIAGPVLLILVHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JwaNP_609901.5 PRA1 62..220 CDD:281235 61/165 (37%)
PRAF2NP_009144.1 PRA1 4..149 CDD:367393 61/166 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149382
Domainoid 1 1.000 102 1.000 Domainoid score I6843
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4749
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49062
OrthoDB 1 1.010 - - D1288023at2759
OrthoFinder 1 1.000 - - FOG0003654
OrthoInspector 1 1.000 - - otm41949
orthoMCL 1 0.900 - - OOG6_105959
Panther 1 1.100 - - LDO PTHR12859
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3380
SonicParanoid 1 1.000 - - X2527
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.