DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jwa and arl6ip5

DIOPT Version :9

Sequence 1:NP_609901.5 Gene:Jwa / 35128 FlyBaseID:FBgn0032704 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001120902.1 Gene:arl6ip5 / 100151730 XenbaseID:XB-GENE-482901 Length:188 Species:Xenopus tropicalis


Alignment Length:193 Identity:76/193 - (39%)
Similarity:108/193 - (55%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NLQLPPLRTLDDFILGSARFQLPNLKDFEKWGNRVVKNLLYYQTNYFLLFITIYVLMIFFNP-SK 123
            ::|:.|||..:||..||.||.:|:.||..||.|||:.|||||||||..:...:..|:.|||| ..
 Frog     2 DVQVAPLRPWEDFFPGSDRFAVPDFKDISKWNNRVISNLLYYQTNYLAMAAAVICLVGFFNPFGM 66

  Fly   124 IITGLLVQALIIGVIW-----QFFSGKSKKNFIASRLTGGNANAAEQNAQQKWYILAGALLGGYL 183
            |:.|.:|..:.:|.:|     .||. |.||.:..:                  :||| .|:..|.
 Frog    67 ILGGTIVVLIFLGFVWTSHNKDFFR-KFKKQYPTA------------------FILA-ILVSSYF 111

  Fly   184 LLHLLSAVLLTIFTVLLPISLTFIHASLRLRNIKNKLTNSIESFA-PSTPMGSLLDALNVRAE 245
            ::.|...|::.:|.:.||:.|.||||||||||:|||:.|.:|... ..||||.:|:||..:.|
 Frog   112 IISLFGDVMVFVFGITLPMLLMFIHASLRLRNLKNKVENKMEGIGLKKTPMGIVLEALEQQEE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JwaNP_609901.5 PRA1 62..220 CDD:281235 65/163 (40%)
arl6ip5NP_001120902.1 PRA1 3..147 CDD:397359 64/163 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6047
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4673
Inparanoid 1 1.050 129 1.000 Inparanoid score I4525
OMA 1 1.010 - - QHG49062
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003654
OrthoInspector 1 1.000 - - oto104901
Panther 1 1.100 - - O PTHR12859
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2527
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.070

Return to query results.
Submit another query.