DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10343 and GIR2

DIOPT Version :9

Sequence 1:NP_609900.1 Gene:CG10343 / 35127 FlyBaseID:FBgn0032703 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_010436.3 Gene:GIR2 / 851730 SGDID:S000002559 Length:265 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:54/238 - (22%)
Similarity:81/238 - (34%) Gaps:70/238 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EQQTEEREALQSIYEGDTNF--KEIDSVTFQYKY------GEEDNY----KSFLVELKWGENYPD 58
            |:|.:|.|.|:|||..:...  .|...:.|:...      |:..:.    .:.:.|.|..|||||
Yeast     5 EEQKQELEVLESIYPDELRIINDEYPKIKFEVAIKLELDTGDSTSVLTKEHTIIAEFKLPENYPD 69

  Fly    59 EAPAINMNA-------------------------------FYN-------RNLLPAVKEGIQTAL 85
            |...|::.|                               |.|       :..||.:.  :|...
Yeast    70 EPCLISLEAQEVALNDNEEDNEEDEDEVEYDDHGNKVLKKFENLPDLISFKGYLPELT--VQLES 132

  Fly    86 STEADQWLGCGMTYTLFECLKDNLEQLTAEQPESAPTVALVDDGVGALKISDPNADAESKKKEPK 150
            ..|.|..||..|.:.|...:|:..||..:||             :..|:........|.:|||..
Yeast   133 QIETDMLLGMQMCFALISSIKERCEQWYSEQ-------------LNKLEKQYELEAQEREKKEQA 184

  Fly   151 KEHLTKAQKRR--QWERTDHKGDRERGWDWVDLVKHLSQTGGK 191
            |.|.||..:..  :|.   .|..:|...|..|.|:.:....||
Yeast   185 KFHGTKVTRESYLEWR---SKFRQELKLDERDQVRRMKAHHGK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10343NP_609900.1 RWD 6..109 CDD:283440 33/152 (22%)
GIR2NP_010436.3 RWD 5..154 CDD:399058 32/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.