DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10343 and Rwdd1

DIOPT Version :9

Sequence 1:NP_609900.1 Gene:CG10343 / 35127 FlyBaseID:FBgn0032703 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_079890.1 Gene:Rwdd1 / 66521 MGIID:1913771 Length:243 Species:Mus musculus


Alignment Length:222 Identity:56/222 - (25%)
Similarity:85/222 - (38%) Gaps:44/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EQQTEEREALQSIY--------EGDTNFKEIDSVTFQYKYGEEDNYKSFLVELKWGENYPDEAPA 62
            |:|..|.|||:|||        |...:|    ::|...:.||.|......::..:.|.||||.|.
Mouse     6 EEQRNELEALESIYPDSFTVLSESPPSF----TITVTSEAGENDETVQTTLKFTYSEKYPDETPL 66

  Fly    63 INMNAFYNRNLLPAVKEGIQTALSTEADQWLGCGMTYTLFECLKDNLEQL-----TAEQPESAPT 122
            ..:  |...||.......|...|:.:|::.||..|.:||...:::.|.::     |..:.|....
Mouse    67 YEI--FSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQK 129

  Fly   123 VALVDDGVGALKISDP-----------NADA---ESKKKEPKKEHLTKAQK--RRQWERTDHKGD 171
            ....::....|....|           ..||   |.|||..|:|......|  .:|...|||..|
Mouse   130 EKEAEEAEKKLFHGTPVTIENFLSWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLD 194

  Fly   172 RERGWDWVDLVKHLSQTGG--KNDDSL 196
            ...       ::.|...|.  :.|:||
Mouse   195 TSD-------IQFLEDAGNNVEVDESL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10343NP_609900.1 RWD 6..109 CDD:283440 32/110 (29%)
Rwdd1NP_079890.1 RWD 6..111 CDD:310403 32/110 (29%)
Interaction with DRG2. /evidence=ECO:0000269|PubMed:15676025 142..197 15/54 (28%)
DFRP_C <144..>197 CDD:330458 15/52 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..243 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.