DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10343 and RWDD1

DIOPT Version :10

Sequence 1:NP_609900.1 Gene:CG10343 / 35127 FlyBaseID:FBgn0032703 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_057036.2 Gene:RWDD1 / 51389 HGNCID:20993 Length:243 Species:Homo sapiens


Alignment Length:104 Identity:24/104 - (23%)
Similarity:37/104 - (35%) Gaps:27/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSKLRV-----LNFNENRIHRLSNSATKHCRFYDTLQTLSISKNLMKQFHLDLFNPFG----SLQ 70
            |.:||.     |:..:..||.|....:: ..|.|.:.::.:...|....||.     |    :||
Human    23 LDELRCHFTWELDIKDKHIHDLEIKISE-TEFRDPIYSIGMHNLLAYVRHLK-----GQQDEALQ 81

  Fly    71 LLEAKHNAIMSIRGSFNSVAYLTLVLTKNKLKTLDLCRW 109
            .|:.....|.|.:            |:|..|.|...|.|
Human    82 SLKEAEALIQSEQ------------LSKRSLATWGNCAW 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10343NP_609900.1 RWD-RWDD4 10..112 CDD:467653 24/104 (23%)
RWDD1NP_057036.2 RWD_RWDD1 4..119 CDD:467652 24/104 (23%)
Interaction with DRG2. /evidence=ECO:0000250 142..197
DFRP_C <144..>197 CDD:465167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..243
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.