DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10343 and rwdd1

DIOPT Version :9

Sequence 1:NP_609900.1 Gene:CG10343 / 35127 FlyBaseID:FBgn0032703 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001002535.2 Gene:rwdd1 / 436808 ZFINID:ZDB-GENE-040718-270 Length:240 Species:Danio rerio


Alignment Length:218 Identity:57/218 - (26%)
Similarity:90/218 - (41%) Gaps:43/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EQQTEEREALQSIY--------EGDTNFKEIDSVTFQYKYGEEDNYKSFLVELKWGENYPDEAPA 62
            |:|..|.||::|||        :..|:|    ::|.....||.:......::..:.|.||||.|.
Zfish     6 EEQRNELEAIESIYPDSFTVLSDAPTSF----TITVTSDTGENEETLELTLKFTYVEKYPDEPPL 66

  Fly    63 INMNAFYNRNLLPAVKEGIQTALSTEADQWLGCGMTYTLFECLKDNL-----------------E 110
              ...|...||..:..|.|.|.|..:|::.||..|.:||...:::.|                 :
Zfish    67 --WEIFSQENLEDSDAEEILTLLKQQAEENLGMVMIFTLVTAVQEKLNEIIDQIKSRREEEKQRK 129

  Fly   111 QLTAEQPESAP---TVALVDDGVGALKISDPNADAESKKKEPKKEHLTKAQK--RRQWERTDHKG 170
            |..||:.|...   ||..::..: :.|........|.|||..|:|..:..:|  .:|...|||..
Zfish   130 QKEAEEAEKRAFQGTVVTIETFL-SWKAKFEAEMIELKKKRQKEEEQSGKKKLTGKQLFETDHNL 193

  Fly   171 DR------ERGWDWVDLVKHLSQ 187
            |.      |.|.:.|::.:.|.|
Zfish   194 DTSDIQFLEDGGNSVEVDESLFQ 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10343NP_609900.1 RWD 6..109 CDD:283440 32/110 (29%)
rwdd1NP_001002535.2 RWD 3..111 CDD:283440 32/110 (29%)
DFRP_C 144..>197 CDD:293151 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.