DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10343 and CG15605

DIOPT Version :10

Sequence 1:NP_609900.1 Gene:CG10343 / 35127 FlyBaseID:FBgn0032703 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_611191.1 Gene:CG15605 / 36933 FlyBaseID:FBgn0034196 Length:152 Species:Drosophila melanogaster


Alignment Length:60 Identity:14/60 - (23%)
Similarity:25/60 - (41%) Gaps:3/60 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GEEDNYKSFLVELKWGENYPDEAPAINMNAFYNRNLLPAVKEGIQTALSTEADQWLGCGM 97
            ||...|...|: .....|||...|.:.:  ...||:..|.::.::..:....::.||..|
  Fly    75 GERGGYALQLL-FTCAANYPLARPLVEI--VEKRNVSDAFEQVLRKEIDLILEEHLGLQM 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10343NP_609900.1 RWD-RWDD4 10..112 CDD:467653 14/60 (23%)
CG15605NP_611191.1 RWD 33..145 CDD:214735 14/60 (23%)

Return to query results.
Submit another query.