powered by:
Protein Alignment CG10343 and CG15605
DIOPT Version :9
Sequence 1: | NP_609900.1 |
Gene: | CG10343 / 35127 |
FlyBaseID: | FBgn0032703 |
Length: | 214 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611191.1 |
Gene: | CG15605 / 36933 |
FlyBaseID: | FBgn0034196 |
Length: | 152 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 14/60 - (23%) |
Similarity: | 25/60 - (41%) |
Gaps: | 3/60 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 GEEDNYKSFLVELKWGENYPDEAPAINMNAFYNRNLLPAVKEGIQTALSTEADQWLGCGM 97
||...|...|: .....|||...|.:.: ...||:..|.::.::..:....::.||..|
Fly 75 GERGGYALQLL-FTCAANYPLARPLVEI--VEKRNVSDAFEQVLRKEIDLILEEHLGLQM 131
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10343 | NP_609900.1 |
RWD |
6..109 |
CDD:283440 |
14/60 (23%) |
CG15605 | NP_611191.1 |
RWD |
33..145 |
CDD:214735 |
14/60 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4018 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.