DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10343 and T26E3.4

DIOPT Version :9

Sequence 1:NP_609900.1 Gene:CG10343 / 35127 FlyBaseID:FBgn0032703 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_493207.1 Gene:T26E3.4 / 173136 WormBaseID:WBGene00012037 Length:240 Species:Caenorhabditis elegans


Alignment Length:180 Identity:48/180 - (26%)
Similarity:78/180 - (43%) Gaps:34/180 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EQQTEEREALQSIYE------GDTNFKEID-SVTFQYKYGEEDNYKSFLVEL--KWGENYPDEAP 61
            |||.:|.|||::||.      ...::..|: |:..:....|:.....|.|||  ::.||||||.|
 Worm     5 EQQEQEIEALEAIYSEEEIHVASRDYPNIELSIQLKSNQYEDPTDDDFDVELGIEFTENYPDEIP 69

  Fly    62 AINMNAFYNRNLLPAVKEGIQTALSTEADQWLGCGMTYTLFECLKDNLEQLTAEQPESAPTVALV 126
            .|.:|...:......:.|.|. .|.:.|::.||..|.:.:...|:|.:.:|.             
 Worm    70 IITLNGIEDAFTAERIAESID-KLRSVAEENLGMVMVFAIVSALQDEIGELV------------- 120

  Fly   127 DDGVGALKISDPNADAESKKKEPKKEHLTKAQKRRQWERTDHKGDRERGW 176
                      |....|:.:|.|.:||. .:|:.|:::|.|....|..|.|
 Worm   121 ----------DVKKRAKEEKVEIEKEK-KEAESRKKFEGTVVTPDTFRAW 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10343NP_609900.1 RWD 6..109 CDD:283440 34/111 (31%)
T26E3.4NP_493207.1 RWD 13..116 CDD:368608 29/103 (28%)
DFRP_C <149..221 CDD:374615 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.