DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and pphC

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_416576.1 Gene:pphC / 947269 ECOCYCID:G7111 Length:253 Species:Escherichia coli


Alignment Length:207 Identity:46/207 - (22%)
Similarity:78/207 - (37%) Gaps:43/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 ESAFLLADE--RFTQKKITSGTTSV-------CALITKDQLYIAWVGDSKALLVG--KRTQLQLV 295
            |.|.|..:|  .:..:|:..|...:       ..|..:.:|:..  .::|.|.|.  ..|.|.|:
E. coli    56 EGAMLAVNEAMAYMSQKVQGGELGLNDVLATNMVLTIRQRLFAE--AEAKELAVRDFACTFLGLI 118

  Fly   296 KPHKPENPDERKRIETAGGTVLHAQGQWRVNGI-LNVARSIGDY-SLEAVIAEPDFVD-----VQ 353
                 .:||....::...|.|:...|    :|: |.:....|:| ::...|.:.|.|.     ..
E. coli   119 -----SSPDGTLIMQIGDGGVVVDLG----HGLQLPLTPMAGEYANMTHFITDEDAVSRLETFTS 174

  Fly   354 LNEAHDFLVLGTDG-------LWDHVPESLIIETVYDSLADTTM-KLDDIPKLLIE-----AAKE 405
            ...||..... |||       :.|:.|........::.||..|. :||.:|:||.:     |..|
E. coli   175 TGRAHKVAAF-TDGIQRLALNMLDNSPHVPFFTPFFNGLAAATQEQLDLLPELLKQFLSSPAVNE 238

  Fly   406 RDSQDNITAVVV 417
            |...|...|:.:
E. coli   239 RTDDDKTLALAL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 46/207 (22%)
pphCNP_416576.1 PP2C_2 11..219 CDD:404547 36/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.