DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PTC2

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_011013.1 Gene:PTC2 / 856823 SGDID:S000000891 Length:464 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:68/248 - (27%)
Similarity:114/248 - (45%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 FFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFTQ----K 255
            |:|:||||.|:..|.|..:::.::|.:|       .:|.......|....|:..|.:..|    |
Yeast    57 FYGIFDGHGGAKVAEYCGNKIVEILQEQ-------KSFHEGNLPRALIDTFINTDVKLLQDPVMK 114

  Fly   256 KITSGTTSVCALITKDQ--LYIAWVGDSKALLVGKRTQLQLVKPHKPENPDERKRIETAGGTVLH 318
            :..||.|:...|::|.|  |.....|||:.:|........|...|||....|:.||..|.|.|  
Yeast   115 EDHSGCTATSILVSKSQNLLVCGNAGDSRTVLATDGNAKALSYDHKPTLASEKSRIVAADGFV-- 177

  Fly   319 AQGQWRVNGILNVARSIGDYSLEA----------VIAEPDFVDVQLN-EAHDFLVLGTDGLWDHV 372
              ...||||.|.::|:|||:..::          |...||.::..|: :..:|::|..||:||.:
Yeast   178 --EMDRVNGNLALSRAIGDFEFKSNPKLGPEEQIVTCVPDILEHSLDYDRDEFVILACDGIWDCL 240

  Fly   373 PESLIIETVYDSLADTTMKLDDIPKLLIEAAKERDSQ------DNITAVVVLL 419
            .....::.|:..|.: ...|::|...:|:......::      ||::.|||.|
Yeast   241 TSQDCVDLVHLGLRE-GKTLNEISSRIIDVCCAPTTEGTGIGCDNMSIVVVAL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 67/246 (27%)
PTC2NP_011013.1 PP2C 23..279 CDD:395385 62/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13832
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.