DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PTC4

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_009683.1 Gene:PTC4 / 852422 SGDID:S000000329 Length:393 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:83/309 - (26%)
Similarity:129/309 - (41%) Gaps:78/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 FGEMYELLDKTTRFFGVFDGHSGSLSATYAT-------------------SQLPQLLADQLK--- 224
            |.:.||.|  :...|.|||||.|...:.:.:                   :.|.:.:|...:   
Yeast    67 FIDKYETL--SLNVFAVFDGHGGDDCSKFLSGGRHHRDGNGSSNGNGEPNAGLIKWIAYSFENHH 129

  Fly   225 ----ANPDPAAFSPDF------YRNAFESAFLLADERFTQKKITS--GTTSVCA-LITKDQLYIA 276
                .|.|.:.|...|      ....|:.||:|.||...:....|  |:|:|.| :|.::.||:|
Yeast   130 YTSTTNNDSSKFKRSFNTLEGLVSQIFKDAFILQDEELYRHFANSSCGSTAVVACIINEESLYVA 194

  Fly   277 WVGDSKALLVGKRTQLQLVK-PHKPENPDERKRIETAGGTVLHAQGQWRVNGILNVARSIGDYSL 340
            ..|||:.:|..|...::.:. .|||::..|..||...||||    ...||.|:|.::|:..|:..
Yeast   195 NCGDSRCILSSKSNGIKTMSFDHKPQHIGELIRINDNGGTV----SLGRVGGVLALSRAFSDFQF 255

  Fly   341 E----------------------------AVIAEPDFVDVQLNEAHD-FLVLGTDGLWDHVPESL 376
            :                            .|..|||.:..:::.:.| ||||..||:||......
Yeast   256 KRGVTYPHRRTKLTNITQNLTYGTPPQEAQVTVEPDVLMHKIDYSKDEFLVLACDGIWDIYNNKQ 320

  Fly   377 IIETVYDSLADTTMKLDD-IPKLLIEAAKERDSQ-----DNITAVVVLL 419
            :|..:...|...| |||. |.|||.....:.:|.     ||:||::|:|
Yeast   321 LIHFIKYHLVSGT-KLDTIITKLLDHGIAQANSNTGVGFDNMTAIIVVL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 82/307 (27%)
PTC4NP_009683.1 PP2C 82..355 CDD:395385 71/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13832
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.