DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and PPM1D

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_003611.1 Gene:PPM1D / 8493 HGNCID:9277 Length:605 Species:Homo sapiens


Alignment Length:321 Identity:90/321 - (28%)
Similarity:141/321 - (43%) Gaps:70/321 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 QQKEPLHTSAAVKNKPRKMEDRCVCLDRFGEMYELLDKTTRFFGVFDGHSGSLSATYATSQLPQL 218
            :.::||..:.|     .....|| |..|         .:..||.|.|||.|..:|.:|...|...
Human    74 EARDPLPDAGA-----SPAPSRC-CRRR---------SSVAFFAVCDGHGGREAAQFAREHLWGF 123

  Fly   219 LADQLK-ANPDPAAFSPDFYRNAFESAFL-----LAD--ERFTQKKITSGTTSVCALITKDQLYI 275
            :..|.. .:.:||...... |..|.:..|     ||:  :..|....|||||:...:|...::|:
Human   124 IKKQKGFTSSEPAKVCAAI-RKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVIIRGMKMYV 187

  Fly   276 AWVGDSKALLVGKRTQ--------LQLVKPHKPENPDERKRIETAGGTVLHAQGQWRV------- 325
            |.|||| .:::|.:..        :::.:.||||.|.||:|||..||:|::..|..||       
Human   188 AHVGDS-GVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRL 251

  Fly   326 --NG------------ILNVARSIGD------YSLEAVIA-EPDFVDVQLN-EAHDFLVLGTDGL 368
              ||            .|.|||::||      :|.|.|:: |||.....|: :.|.:::||:|||
Human   252 THNGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGL 316

  Fly   369 WDHVPESLIIETVYDSLADTTMKLD---DIPKLLIEAAKERDSQ-----DNITAVVVLLKP 421
            |:.:|....|....|......:..:   ...|:|:..|..|..|     ||.:|:|:.:.|
Human   317 WNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 87/311 (28%)
PPM1DNP_003611.1 Interaction with CHEK1. /evidence=ECO:0000269|PubMed:15870257 1..101 7/41 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..90 3/20 (15%)
PP2C 67..368 CDD:278884 86/310 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.