DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10376 and AT1G78200

DIOPT Version :9

Sequence 1:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001323238.1 Gene:AT1G78200 / 844156 AraportID:AT1G78200 Length:283 Species:Arabidopsis thaliana


Alignment Length:271 Identity:88/271 - (32%)
Similarity:129/271 - (47%) Gaps:46/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VKNKP-RKMEDRCVCLDRFGEMYELLDKTTRF-------FGVFDGHSGSLSATYATSQLPQLLAD 221
            :|.|. ..|||..|.            |.|.|       |.:||||.|...|.|....|...:..
plant    38 IKGKSNHSMEDYHVA------------KFTNFNGNELGLFAIFDGHKGDHVAAYLQKHLFSNILK 90

  Fly   222 QLKANPDPAAFSPDFYRNAFESAFLLADERFTQKKITSGTTSVCA-LITKDQLYIAWVGDSKALL 285
            ..:...||.......|.|..:.  :|||.|...:  :.|:|:|.| ||....|:||.||||:|::
plant    91 DGEFLVDPRRAIAKAYENTDQK--ILADNRTDLE--SGGSTAVTAILINGKALWIANVGDSRAIV 151

  Fly   286 VGKRTQLQLVKPHKPENPDERKRIETAGGTVLHAQGQW-RVNGILNVARSIGDYSLEAVI-AEPD 348
            ..:....|:...|.|::..||..||:.||.|.:..|.. ||||:|.|:|..||.:|:|.: :||:
plant   152 SSRGKAKQMSVDHDPDDDTERSMIESKGGFVTNRPGDVPRVNGLLAVSRVFGDKNLKAYLNSEPE 216

  Fly   349 FVDVQLNEAHDFLVLGTDGLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKE-------R 406
            ..||.::...|||:|.:||:      |.::..  ....|...||.| ||   |||::       |
plant   217 IKDVTIDSHTDFLILASDGI------SKVMSN--QEAVDVAKKLKD-PK---EAARQVVAEALKR 269

  Fly   407 DSQDNITAVVV 417
            :|:|:|:.:||
plant   270 NSKDDISCIVV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 88/271 (32%)
AT1G78200NP_001323238.1 PP2Cc 31..282 CDD:238083 88/271 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1044139at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.